Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   WHO32_RS13365 Genome accession   NZ_CP148112
Coordinates   2552033..2552206 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis isolate FELIX_MS504     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2547033..2557206
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO32_RS13350 gcvT 2547832..2548920 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  WHO32_RS13355 yqhH 2549362..2551035 (+) 1674 WP_004398544.1 SNF2-related protein -
  WHO32_RS13360 yqhG 2551056..2551850 (+) 795 WP_003230200.1 YqhG family protein -
  WHO32_RS13365 sinI 2552033..2552206 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WHO32_RS13370 sinR 2552240..2552575 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WHO32_RS13375 tasA 2552668..2553453 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  WHO32_RS13380 sipW 2553517..2554089 (-) 573 WP_003246088.1 signal peptidase I -
  WHO32_RS13385 tapA 2554073..2554834 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  WHO32_RS13390 yqzG 2555106..2555432 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WHO32_RS13395 spoIIT 2555474..2555653 (-) 180 WP_003230176.1 YqzE family protein -
  WHO32_RS13400 comGG 2555724..2556098 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  WHO32_RS13405 comGF 2556099..2556482 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  WHO32_RS13410 comGE 2556508..2556855 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=950840 WHO32_RS13365 WP_003230187.1 2552033..2552206(+) (sinI) [Bacillus subtilis isolate FELIX_MS504]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=950840 WHO32_RS13365 WP_003230187.1 2552033..2552206(+) (sinI) [Bacillus subtilis isolate FELIX_MS504]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1