Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   WHL98_RS17235 Genome accession   NZ_CP148104
Coordinates   3257944..3258084 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis isolate FELIX_MS438     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3252944..3263084
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHL98_RS17210 yuxO 3253257..3253637 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHL98_RS17215 comA 3253656..3254300 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHL98_RS17220 comP 3254381..3256690 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  WHL98_RS17225 comX 3256705..3256872 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHL98_RS17230 comQ 3256860..3257759 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHL98_RS17235 degQ 3257944..3258084 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHL98_RS17240 - 3258306..3258431 (+) 126 WP_003228793.1 hypothetical protein -
  WHL98_RS17245 - 3258545..3258913 (+) 369 WP_003243784.1 hypothetical protein -
  WHL98_RS17250 pdeH 3258889..3260118 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHL98_RS17255 pncB 3260255..3261727 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  WHL98_RS17260 pncA 3261743..3262294 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  WHL98_RS17265 yueI 3262391..3262789 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=950627 WHL98_RS17235 WP_003220708.1 3257944..3258084(-) (degQ) [Bacillus subtilis subsp. subtilis isolate FELIX_MS438]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=950627 WHL98_RS17235 WP_003220708.1 3257944..3258084(-) (degQ) [Bacillus subtilis subsp. subtilis isolate FELIX_MS438]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1