Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   WHL98_RS17225 Genome accession   NZ_CP148104
Coordinates   3256705..3256872 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis subsp. subtilis isolate FELIX_MS438     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3251705..3261872
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHL98_RS17195 mrpE 3252100..3252576 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  WHL98_RS17200 mrpF 3252576..3252860 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  WHL98_RS17205 mnhG 3252844..3253218 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  WHL98_RS17210 yuxO 3253257..3253637 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHL98_RS17215 comA 3253656..3254300 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHL98_RS17220 comP 3254381..3256690 (-) 2310 WP_032723438.1 two-component system sensor histidine kinase ComP Regulator
  WHL98_RS17225 comX 3256705..3256872 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHL98_RS17230 comQ 3256860..3257759 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHL98_RS17235 degQ 3257944..3258084 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHL98_RS17240 - 3258306..3258431 (+) 126 WP_003228793.1 hypothetical protein -
  WHL98_RS17245 - 3258545..3258913 (+) 369 WP_003243784.1 hypothetical protein -
  WHL98_RS17250 pdeH 3258889..3260118 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHL98_RS17255 pncB 3260255..3261727 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=950625 WHL98_RS17225 WP_003242801.1 3256705..3256872(-) (comX) [Bacillus subtilis subsp. subtilis isolate FELIX_MS438]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=950625 WHL98_RS17225 WP_003242801.1 3256705..3256872(-) (comX) [Bacillus subtilis subsp. subtilis isolate FELIX_MS438]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1