Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   WHL51_RS15690 Genome accession   NZ_CP148102
Coordinates   3046919..3047059 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus spizizenii str. W23     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3041919..3052059
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHL51_RS15665 - 3042243..3042623 (-) 381 WP_003220719.1 hotdog fold thioesterase -
  WHL51_RS15670 comA 3042639..3043283 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHL51_RS15675 comP 3043364..3045688 (-) 2325 WP_003220714.1 histidine kinase Regulator
  WHL51_RS15680 comX 3045696..3045860 (-) 165 WP_003220712.1 competence pheromone ComX -
  WHL51_RS15685 - 3045873..3046733 (-) 861 WP_003220710.1 polyprenyl synthetase family protein -
  WHL51_RS15690 degQ 3046919..3047059 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHL51_RS15695 - 3047291..3047407 (+) 117 WP_136975871.1 hypothetical protein -
  WHL51_RS15700 - 3047522..3047890 (+) 369 WP_003220698.1 hypothetical protein -
  WHL51_RS15705 pdeH 3047866..3049095 (-) 1230 WP_003220696.1 cyclic di-GMP phosphodiesterase -
  WHL51_RS15710 - 3049230..3050702 (-) 1473 WP_003220693.1 nicotinate phosphoribosyltransferase -
  WHL51_RS15715 - 3050718..3051269 (-) 552 WP_003220692.1 cysteine hydrolase family protein -
  WHL51_RS15720 - 3051366..3051764 (-) 399 WP_003220689.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=950455 WHL51_RS15690 WP_003220708.1 3046919..3047059(-) (degQ) [Bacillus spizizenii str. W23]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=950455 WHL51_RS15690 WP_003220708.1 3046919..3047059(-) (degQ) [Bacillus spizizenii str. W23]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1