Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   WFE12_RS13405 Genome accession   NZ_CP147877
Coordinates   2557922..2558305 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2552922..2563305
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WFE12_RS13365 sinI 2553856..2554029 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WFE12_RS13370 sinR 2554063..2554398 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WFE12_RS13375 tasA 2554491..2555276 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  WFE12_RS13380 sipW 2555340..2555912 (-) 573 WP_003246088.1 signal peptidase I -
  WFE12_RS13385 tapA 2555896..2556657 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  WFE12_RS13390 yqzG 2556929..2557255 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WFE12_RS13395 spoIIT 2557297..2557476 (-) 180 WP_003230176.1 YqzE family protein -
  WFE12_RS13400 comGG 2557547..2557921 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  WFE12_RS13405 comGF 2557922..2558305 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  WFE12_RS13410 comGE 2558331..2558678 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  WFE12_RS13415 comGD 2558662..2559093 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  WFE12_RS13420 comGC 2559083..2559379 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  WFE12_RS13425 comGB 2559393..2560430 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  WFE12_RS13430 comGA 2560417..2561487 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  WFE12_RS13435 corA 2561899..2562852 (-) 954 WP_032723504.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=949148 WFE12_RS13405 WP_003230168.1 2557922..2558305(-) (comGF) [Bacillus subtilis subsp. subtilis str. 168]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=949148 WFE12_RS13405 WP_003230168.1 2557922..2558305(-) (comGF) [Bacillus subtilis subsp. subtilis str. 168]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1