Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   WFE12_RS13365 Genome accession   NZ_CP147877
Coordinates   2553856..2554029 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2548856..2559029
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WFE12_RS13350 gcvT 2549655..2550743 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  WFE12_RS13355 yqhH 2551185..2552858 (+) 1674 WP_004398544.1 SNF2-related protein -
  WFE12_RS13360 yqhG 2552879..2553673 (+) 795 WP_003230200.1 YqhG family protein -
  WFE12_RS13365 sinI 2553856..2554029 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WFE12_RS13370 sinR 2554063..2554398 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WFE12_RS13375 tasA 2554491..2555276 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  WFE12_RS13380 sipW 2555340..2555912 (-) 573 WP_003246088.1 signal peptidase I -
  WFE12_RS13385 tapA 2555896..2556657 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  WFE12_RS13390 yqzG 2556929..2557255 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WFE12_RS13395 spoIIT 2557297..2557476 (-) 180 WP_003230176.1 YqzE family protein -
  WFE12_RS13400 comGG 2557547..2557921 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  WFE12_RS13405 comGF 2557922..2558305 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  WFE12_RS13410 comGE 2558331..2558678 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=949145 WFE12_RS13365 WP_003230187.1 2553856..2554029(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=949145 WFE12_RS13365 WP_003230187.1 2553856..2554029(+) (sinI) [Bacillus subtilis subsp. subtilis str. 168]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1