Detailed information NTG0948895

Bioinformatically predicted

Overview

• Name: comGF/cglF
• Type: Machinery gene
• Locus tag: ACG3JL_RS00495
• Genome accession: NZ_CP171737
• Coordinates: 81070..81507 (+)
• Length: 145 a.a.
• NCBI ID: WP_003102915.1
• Uniprot ID: A0ABN0IPC0
• Organism: Streptococcus parauberis strain DB-M18
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 76070..86507

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACG3JL_RS00460 (ACG3JL_00460)	-	77715..78053 (+)	339	WP_013794400.1	DUF1366 domain-containing protein	-
ACG3JL_RS00465 (ACG3JL_00465)	-	78116..78265 (+)	150	WP_259966511.1	hypothetical protein	-
ACG3JL_RS00470 (ACG3JL_00470)	-	78269..78733 (+)	465	WP_013794399.1	phage holin family protein	-
ACG3JL_RS00475 (ACG3JL_00475)	-	78726..79451 (+)	726	WP_013794398.1	peptidoglycan amidohydrolase family protein	-
ACG3JL_RS00480 (ACG3JL_00480)	comGC	80104..80424 (+)	321	WP_013794397.1	competence type IV pilus major pilin ComGC	Machinery gene
ACG3JL_RS00485 (ACG3JL_00485)	comGD	80414..80821 (+)	408	WP_243619590.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACG3JL_RS00490 (ACG3JL_00490)	comGE	80793..81092 (+)	300	WP_259966510.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACG3JL_RS00495 (ACG3JL_00495)	comGF/cglF	81070..81507 (+)	438	WP_003102915.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACG3JL_RS00500 (ACG3JL_00500)	comGG	81485..81982 (+)	498	WP_003108640.1	competence type IV pilus minor pilin ComGG	-
ACG3JL_RS00505 (ACG3JL_00505)	comGH	82089..83045 (+)	957	WP_003103712.1	class I SAM-dependent methyltransferase	Machinery gene
ACG3JL_RS00510 (ACG3JL_00510)	-	83101..84294 (+)	1194	WP_003108638.1	acetate kinase	-
ACG3JL_RS00515 (ACG3JL_00515)	-	84405..84617 (+)	213	WP_003108636.1	helix-turn-helix transcriptional regulator	-
ACG3JL_RS00520 (ACG3JL_00520)	-	84610..85062 (+)	453	WP_003108634.1	hypothetical protein	-
ACG3JL_RS00525 (ACG3JL_00525)	-	85071..85724 (+)	654	WP_013794395.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16538.25 Da
• Isoelectric Point: 9.7525

>NTDB_id=948895 ACG3JL_RS00495 WP_003102915.1 81070..81507(+) (comGF/cglF) [Streptococcus parauberis strain DB-M18]
MLQKLVTKGFTLFEALIALLVISGSLLVYQGLTKSTFANMNYLSQSDQDSWLLFANQFRAELEGSQFIEIKGKKMLVKKD
EKVVSFRLTEKNDFRKSAASGKGLNPMLLNLQDIQMTTVNHQLTLHLIWQSGLERDFIYAFEKPS

Nucleotide

• Length: 438 bp

>NTDB_id=948895 ACG3JL_RS00495 WP_003102915.1 81070..81507(+) (comGF/cglF) [Streptococcus parauberis strain DB-M18]
ATGTTACAAAAATTAGTGACTAAGGGTTTTACCTTATTTGAAGCCTTAATTGCACTTTTAGTTATCTCTGGATCTCTACT
GGTTTATCAAGGTTTAACTAAGTCAACGTTTGCCAATATGAACTATCTAAGTCAAAGTGATCAAGATAGTTGGCTCTTAT
TTGCAAATCAGTTTAGAGCTGAATTGGAAGGTTCACAATTTATTGAAATTAAAGGAAAAAAAATGCTTGTTAAAAAGGAT
GAAAAGGTAGTTTCTTTTAGATTAACTGAAAAAAATGACTTTAGAAAATCGGCAGCTAGTGGGAAAGGCTTAAATCCAAT
GTTGTTAAACTTACAGGATATTCAAATGACGACAGTAAATCACCAACTAACTCTTCATTTGATCTGGCAAAGTGGCCTGG
AAAGGGATTTTATCTATGCATTTGAGAAGCCAAGTTAA

Domains

Predicted by InterProScan.

• Putative Competence protein ComGF (ComGF) (41-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF/cglF	Streptococcus mitis SK321	44.928	95.172	0.428
comGF/cglF	Streptococcus mitis NCTC 12261	43.796	94.483	0.414
comGF	Streptococcus mutans UA140	42.029	95.172	0.4
comGF	Streptococcus mutans UA159	41.304	95.172	0.393
comGF/cglF	Streptococcus pneumoniae R6	40.58	95.172	0.386
comGF/cglF	Streptococcus pneumoniae TIGR4	40.58	95.172	0.386
comGF/cglF	Streptococcus pneumoniae D39	40.58	95.172	0.386
comGF/cglF	Streptococcus pneumoniae Rx1	40.58	95.172	0.386