Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   V9W58_RS16540 Genome accession   NZ_CP146764
Coordinates   3273927..3274067 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain AP202     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3268927..3279067
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V9W58_RS16515 (V9W58_16515) - 3269273..3269656 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  V9W58_RS16520 (V9W58_16520) comA 3269678..3270322 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  V9W58_RS16525 (V9W58_16525) comP 3270403..3272703 (-) 2301 WP_174737231.1 histidine kinase Regulator
  V9W58_RS16530 (V9W58_16530) comX 3272717..3272890 (-) 174 WP_012118314.1 competence pheromone ComX -
  V9W58_RS16535 (V9W58_16535) - 3272859..3273719 (-) 861 WP_157774448.1 polyprenyl synthetase family protein -
  V9W58_RS16540 (V9W58_16540) degQ 3273927..3274067 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  V9W58_RS16545 (V9W58_16545) - 3274533..3274874 (+) 342 WP_072589519.1 hypothetical protein -
  V9W58_RS16550 (V9W58_16550) - 3274881..3276104 (-) 1224 WP_251248223.1 EAL and HDOD domain-containing protein -
  V9W58_RS16555 (V9W58_16555) - 3276234..3277700 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  V9W58_RS16560 (V9W58_16560) - 3277718..3278269 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  V9W58_RS16565 (V9W58_16565) - 3278366..3278764 (-) 399 WP_015240486.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=944606 V9W58_RS16540 WP_003152043.1 3273927..3274067(-) (degQ) [Bacillus velezensis strain AP202]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=944606 V9W58_RS16540 WP_003152043.1 3273927..3274067(-) (degQ) [Bacillus velezensis strain AP202]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891