Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   V9W62_RS12185 Genome accession   NZ_CP146763
Coordinates   2576316..2576753 (-) Length   145 a.a.
NCBI ID   WP_043020787.1    Uniprot ID   -
Organism   Bacillus velezensis strain AP81     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2571316..2581753
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V9W62_RS12135 (V9W62_12135) sinI 2571699..2571872 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  V9W62_RS12140 (V9W62_12140) sinR 2571906..2572241 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  V9W62_RS12145 (V9W62_12145) - 2572289..2573074 (-) 786 WP_007408329.1 TasA family protein -
  V9W62_RS12150 (V9W62_12150) - 2573139..2573723 (-) 585 WP_015240205.1 signal peptidase I -
  V9W62_RS12155 (V9W62_12155) tapA 2573695..2574366 (-) 672 WP_020956077.1 amyloid fiber anchoring/assembly protein TapA -
  V9W62_RS12160 (V9W62_12160) - 2574625..2574954 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  V9W62_RS12165 (V9W62_12165) - 2574995..2575174 (-) 180 WP_003153093.1 YqzE family protein -
  V9W62_RS12170 (V9W62_12170) comGG 2575231..2575608 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  V9W62_RS12175 (V9W62_12175) comGF 2575609..2576109 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  V9W62_RS12180 (V9W62_12180) comGE 2576018..2576332 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  V9W62_RS12185 (V9W62_12185) comGD 2576316..2576753 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  V9W62_RS12190 (V9W62_12190) comGC 2576743..2577051 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  V9W62_RS12195 (V9W62_12195) comGB 2577056..2578093 (-) 1038 WP_043020786.1 competence type IV pilus assembly protein ComGB Machinery gene
  V9W62_RS12200 (V9W62_12200) comGA 2578080..2579150 (-) 1071 WP_043020785.1 competence type IV pilus ATPase ComGA Machinery gene
  V9W62_RS12205 (V9W62_12205) - 2579347..2580297 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  V9W62_RS12210 (V9W62_12210) - 2580443..2581744 (+) 1302 WP_043020784.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16271.77 Da        Isoelectric Point: 10.2475

>NTDB_id=944512 V9W62_RS12185 WP_043020787.1 2576316..2576753(-) (comGD) [Bacillus velezensis strain AP81]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTELLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=944512 V9W62_RS12185 WP_043020787.1 2576316..2576753(-) (comGD) [Bacillus velezensis strain AP81]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACTGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566