Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | V9W62_RS12135 | Genome accession | NZ_CP146763 |
| Coordinates | 2571699..2571872 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain AP81 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2566699..2576872
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V9W62_RS12120 (V9W62_12120) | gcvT | 2567512..2568612 (-) | 1101 | WP_043020790.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| V9W62_RS12125 (V9W62_12125) | - | 2569036..2570706 (+) | 1671 | WP_043020789.1 | SNF2-related protein | - |
| V9W62_RS12130 (V9W62_12130) | - | 2570728..2571522 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| V9W62_RS12135 (V9W62_12135) | sinI | 2571699..2571872 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| V9W62_RS12140 (V9W62_12140) | sinR | 2571906..2572241 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| V9W62_RS12145 (V9W62_12145) | - | 2572289..2573074 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| V9W62_RS12150 (V9W62_12150) | - | 2573139..2573723 (-) | 585 | WP_015240205.1 | signal peptidase I | - |
| V9W62_RS12155 (V9W62_12155) | tapA | 2573695..2574366 (-) | 672 | WP_020956077.1 | amyloid fiber anchoring/assembly protein TapA | - |
| V9W62_RS12160 (V9W62_12160) | - | 2574625..2574954 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| V9W62_RS12165 (V9W62_12165) | - | 2574995..2575174 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| V9W62_RS12170 (V9W62_12170) | comGG | 2575231..2575608 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| V9W62_RS12175 (V9W62_12175) | comGF | 2575609..2576109 (-) | 501 | WP_257474763.1 | competence type IV pilus minor pilin ComGF | - |
| V9W62_RS12180 (V9W62_12180) | comGE | 2576018..2576332 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| V9W62_RS12185 (V9W62_12185) | comGD | 2576316..2576753 (-) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=944509 V9W62_RS12135 WP_003153105.1 2571699..2571872(+) (sinI) [Bacillus velezensis strain AP81]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=944509 V9W62_RS12135 WP_003153105.1 2571699..2571872(+) (sinI) [Bacillus velezensis strain AP81]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |