Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   V9W62_RS12135 Genome accession   NZ_CP146763
Coordinates   2571699..2571872 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain AP81     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2566699..2576872
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V9W62_RS12120 (V9W62_12120) gcvT 2567512..2568612 (-) 1101 WP_043020790.1 glycine cleavage system aminomethyltransferase GcvT -
  V9W62_RS12125 (V9W62_12125) - 2569036..2570706 (+) 1671 WP_043020789.1 SNF2-related protein -
  V9W62_RS12130 (V9W62_12130) - 2570728..2571522 (+) 795 WP_007612541.1 YqhG family protein -
  V9W62_RS12135 (V9W62_12135) sinI 2571699..2571872 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  V9W62_RS12140 (V9W62_12140) sinR 2571906..2572241 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  V9W62_RS12145 (V9W62_12145) - 2572289..2573074 (-) 786 WP_007408329.1 TasA family protein -
  V9W62_RS12150 (V9W62_12150) - 2573139..2573723 (-) 585 WP_015240205.1 signal peptidase I -
  V9W62_RS12155 (V9W62_12155) tapA 2573695..2574366 (-) 672 WP_020956077.1 amyloid fiber anchoring/assembly protein TapA -
  V9W62_RS12160 (V9W62_12160) - 2574625..2574954 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  V9W62_RS12165 (V9W62_12165) - 2574995..2575174 (-) 180 WP_003153093.1 YqzE family protein -
  V9W62_RS12170 (V9W62_12170) comGG 2575231..2575608 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  V9W62_RS12175 (V9W62_12175) comGF 2575609..2576109 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  V9W62_RS12180 (V9W62_12180) comGE 2576018..2576332 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  V9W62_RS12185 (V9W62_12185) comGD 2576316..2576753 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=944509 V9W62_RS12135 WP_003153105.1 2571699..2571872(+) (sinI) [Bacillus velezensis strain AP81]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=944509 V9W62_RS12135 WP_003153105.1 2571699..2571872(+) (sinI) [Bacillus velezensis strain AP81]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702