Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   V9W63_RS11750 Genome accession   NZ_CP146760
Coordinates   2445291..2445728 (-) Length   145 a.a.
NCBI ID   WP_012117983.1    Uniprot ID   -
Organism   Bacillus velezensis strain JJ334     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2440291..2450728
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V9W63_RS11700 (V9W63_11700) sinI 2440675..2440848 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  V9W63_RS11705 (V9W63_11705) sinR 2440882..2441217 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  V9W63_RS11710 (V9W63_11710) - 2441265..2442050 (-) 786 WP_007408329.1 TasA family protein -
  V9W63_RS11715 (V9W63_11715) - 2442115..2442699 (-) 585 WP_007408328.1 signal peptidase I -
  V9W63_RS11720 (V9W63_11720) tapA 2442671..2443342 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  V9W63_RS11725 (V9W63_11725) - 2443601..2443930 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  V9W63_RS11730 (V9W63_11730) - 2443970..2444149 (-) 180 WP_003153093.1 YqzE family protein -
  V9W63_RS11735 (V9W63_11735) comGG 2444206..2444583 (-) 378 WP_007408325.1 competence type IV pilus minor pilin ComGG Machinery gene
  V9W63_RS11740 (V9W63_11740) comGF 2444584..2445084 (-) 501 WP_258566475.1 competence type IV pilus minor pilin ComGF -
  V9W63_RS11745 (V9W63_11745) comGE 2444993..2445307 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  V9W63_RS11750 (V9W63_11750) comGD 2445291..2445728 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  V9W63_RS11755 (V9W63_11755) comGC 2445718..2446026 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  V9W63_RS11760 (V9W63_11760) comGB 2446031..2447068 (-) 1038 WP_032866436.1 competence type IV pilus assembly protein ComGB Machinery gene
  V9W63_RS11765 (V9W63_11765) comGA 2447055..2448125 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  V9W63_RS11770 (V9W63_11770) - 2448317..2449267 (-) 951 WP_032870601.1 magnesium transporter CorA family protein -
  V9W63_RS11775 (V9W63_11775) - 2449413..2450714 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16286.74 Da        Isoelectric Point: 10.2475

>NTDB_id=944314 V9W63_RS11750 WP_012117983.1 2445291..2445728(-) (comGD) [Bacillus velezensis strain JJ334]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=944314 V9W63_RS11750 WP_012117983.1 2445291..2445728(-) (comGD) [Bacillus velezensis strain JJ334]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATATAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572