Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   V9W63_RS11700 Genome accession   NZ_CP146760
Coordinates   2440675..2440848 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain JJ334     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2435675..2445848
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V9W63_RS11685 (V9W63_11685) gcvT 2436488..2437588 (-) 1101 WP_237436471.1 glycine cleavage system aminomethyltransferase GcvT -
  V9W63_RS11690 (V9W63_11690) - 2438012..2439682 (+) 1671 WP_007408331.1 SNF2-related protein -
  V9W63_RS11695 (V9W63_11695) - 2439704..2440498 (+) 795 WP_007408330.1 YqhG family protein -
  V9W63_RS11700 (V9W63_11700) sinI 2440675..2440848 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  V9W63_RS11705 (V9W63_11705) sinR 2440882..2441217 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  V9W63_RS11710 (V9W63_11710) - 2441265..2442050 (-) 786 WP_007408329.1 TasA family protein -
  V9W63_RS11715 (V9W63_11715) - 2442115..2442699 (-) 585 WP_007408328.1 signal peptidase I -
  V9W63_RS11720 (V9W63_11720) tapA 2442671..2443342 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  V9W63_RS11725 (V9W63_11725) - 2443601..2443930 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  V9W63_RS11730 (V9W63_11730) - 2443970..2444149 (-) 180 WP_003153093.1 YqzE family protein -
  V9W63_RS11735 (V9W63_11735) comGG 2444206..2444583 (-) 378 WP_007408325.1 competence type IV pilus minor pilin ComGG Machinery gene
  V9W63_RS11740 (V9W63_11740) comGF 2444584..2445084 (-) 501 WP_258566475.1 competence type IV pilus minor pilin ComGF -
  V9W63_RS11745 (V9W63_11745) comGE 2444993..2445307 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  V9W63_RS11750 (V9W63_11750) comGD 2445291..2445728 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=944311 V9W63_RS11700 WP_003153105.1 2440675..2440848(+) (sinI) [Bacillus velezensis strain JJ334]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=944311 V9W63_RS11700 WP_003153105.1 2440675..2440848(+) (sinI) [Bacillus velezensis strain JJ334]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702