Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | V9W63_RS11700 | Genome accession | NZ_CP146760 |
| Coordinates | 2440675..2440848 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain JJ334 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2435675..2445848
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V9W63_RS11685 (V9W63_11685) | gcvT | 2436488..2437588 (-) | 1101 | WP_237436471.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| V9W63_RS11690 (V9W63_11690) | - | 2438012..2439682 (+) | 1671 | WP_007408331.1 | SNF2-related protein | - |
| V9W63_RS11695 (V9W63_11695) | - | 2439704..2440498 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| V9W63_RS11700 (V9W63_11700) | sinI | 2440675..2440848 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| V9W63_RS11705 (V9W63_11705) | sinR | 2440882..2441217 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| V9W63_RS11710 (V9W63_11710) | - | 2441265..2442050 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| V9W63_RS11715 (V9W63_11715) | - | 2442115..2442699 (-) | 585 | WP_007408328.1 | signal peptidase I | - |
| V9W63_RS11720 (V9W63_11720) | tapA | 2442671..2443342 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| V9W63_RS11725 (V9W63_11725) | - | 2443601..2443930 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| V9W63_RS11730 (V9W63_11730) | - | 2443970..2444149 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| V9W63_RS11735 (V9W63_11735) | comGG | 2444206..2444583 (-) | 378 | WP_007408325.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| V9W63_RS11740 (V9W63_11740) | comGF | 2444584..2445084 (-) | 501 | WP_258566475.1 | competence type IV pilus minor pilin ComGF | - |
| V9W63_RS11745 (V9W63_11745) | comGE | 2444993..2445307 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| V9W63_RS11750 (V9W63_11750) | comGD | 2445291..2445728 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=944311 V9W63_RS11700 WP_003153105.1 2440675..2440848(+) (sinI) [Bacillus velezensis strain JJ334]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=944311 V9W63_RS11700 WP_003153105.1 2440675..2440848(+) (sinI) [Bacillus velezensis strain JJ334]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |