Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   V6Z34_RS12745 Genome accession   NZ_CP145817
Coordinates   2615954..2616331 (-) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain WH-7     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2610954..2621331
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6Z34_RS12705 - 2611454..2612248 (+) 795 WP_014305407.1 YqhG family protein -
  V6Z34_RS12710 sinI 2612425..2612598 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  V6Z34_RS12715 sinR 2612632..2612967 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  V6Z34_RS12720 tasA 2613015..2613800 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  V6Z34_RS12725 sipW 2613864..2614447 (-) 584 Protein_2461 signal peptidase I SipW -
  V6Z34_RS12730 tapA 2614419..2615090 (-) 672 WP_063174755.1 amyloid fiber anchoring/assembly protein TapA -
  V6Z34_RS12735 - 2615349..2615678 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  V6Z34_RS12740 - 2615718..2615897 (-) 180 WP_003153093.1 YqzE family protein -
  V6Z34_RS12745 comGG 2615954..2616331 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  V6Z34_RS12750 comGF 2616332..2616832 (-) 501 WP_232789965.1 competence type IV pilus minor pilin ComGF -
  V6Z34_RS12755 comGE 2616741..2617055 (-) 315 WP_041481885.1 competence type IV pilus minor pilin ComGE Machinery gene
  V6Z34_RS12760 comGD 2617039..2617476 (-) 438 WP_095318402.1 competence type IV pilus minor pilin ComGD Machinery gene
  V6Z34_RS12765 comGC 2617466..2617774 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  V6Z34_RS12770 comGB 2617779..2618816 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  V6Z34_RS12775 comGA 2618803..2619873 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  V6Z34_RS12780 - 2620065..2621015 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=940103 V6Z34_RS12745 WP_014305410.1 2615954..2616331(-) (comGG) [Bacillus velezensis strain WH-7]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=940103 V6Z34_RS12745 WP_014305410.1 2615954..2616331(-) (comGG) [Bacillus velezensis strain WH-7]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512