Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   V6Z34_RS12710 Genome accession   NZ_CP145817
Coordinates   2612425..2612598 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain WH-7     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2607425..2617598
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6Z34_RS12695 gcvT 2608244..2609344 (-) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -
  V6Z34_RS12700 - 2609766..2611436 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  V6Z34_RS12705 - 2611454..2612248 (+) 795 WP_014305407.1 YqhG family protein -
  V6Z34_RS12710 sinI 2612425..2612598 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  V6Z34_RS12715 sinR 2612632..2612967 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  V6Z34_RS12720 tasA 2613015..2613800 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  V6Z34_RS12725 sipW 2613864..2614447 (-) 584 Protein_2461 signal peptidase I SipW -
  V6Z34_RS12730 tapA 2614419..2615090 (-) 672 WP_063174755.1 amyloid fiber anchoring/assembly protein TapA -
  V6Z34_RS12735 - 2615349..2615678 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  V6Z34_RS12740 - 2615718..2615897 (-) 180 WP_003153093.1 YqzE family protein -
  V6Z34_RS12745 comGG 2615954..2616331 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  V6Z34_RS12750 comGF 2616332..2616832 (-) 501 WP_232789965.1 competence type IV pilus minor pilin ComGF -
  V6Z34_RS12755 comGE 2616741..2617055 (-) 315 WP_041481885.1 competence type IV pilus minor pilin ComGE Machinery gene
  V6Z34_RS12760 comGD 2617039..2617476 (-) 438 WP_095318402.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=940101 V6Z34_RS12710 WP_003153105.1 2612425..2612598(+) (sinI) [Bacillus velezensis strain WH-7]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=940101 V6Z34_RS12710 WP_003153105.1 2612425..2612598(+) (sinI) [Bacillus velezensis strain WH-7]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702