Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   V6D45_RS12545 Genome accession   NZ_CP145722
Coordinates   2479945..2480319 (-) Length   124 a.a.
NCBI ID   WP_268393879.1    Uniprot ID   A0A9Q4HHL0
Organism   Bacillus spizizenii strain kcgeb_S11     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2474945..2485319
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6D45_RS12505 (V6D45_12510) - 2475274..2476068 (+) 795 WP_268392645.1 YqhG family protein -
  V6D45_RS12510 (V6D45_12515) sinI 2476254..2476427 (+) 174 WP_338442836.1 anti-repressor SinI family protein Regulator
  V6D45_RS12515 (V6D45_12520) sinR 2476461..2476796 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  V6D45_RS12520 (V6D45_12525) tasA 2476890..2477675 (-) 786 WP_014114390.1 biofilm matrix protein TasA -
  V6D45_RS12525 (V6D45_12530) - 2477739..2478311 (-) 573 WP_338444517.1 signal peptidase I -
  V6D45_RS12530 (V6D45_12535) tapA 2478295..2479056 (-) 762 WP_338442837.1 amyloid fiber anchoring/assembly protein TapA -
  V6D45_RS12535 (V6D45_12540) - 2479326..2479652 (+) 327 WP_268393880.1 YqzG/YhdC family protein -
  V6D45_RS12540 (V6D45_12545) - 2479694..2479873 (-) 180 WP_003226330.1 YqzE family protein -
  V6D45_RS12545 (V6D45_12550) comGG 2479945..2480319 (-) 375 WP_268393879.1 competence type IV pilus minor pilin ComGG Machinery gene
  V6D45_RS12550 (V6D45_12555) comGF 2480320..2480703 (-) 384 WP_268393878.1 competence type IV pilus minor pilin ComGF Machinery gene
  V6D45_RS12555 (V6D45_12560) comGE 2480729..2481076 (-) 348 WP_268393877.1 competence type IV pilus minor pilin ComGE Machinery gene
  V6D45_RS12560 (V6D45_12565) comGD 2481060..2481491 (-) 432 Protein_2424 competence type IV pilus minor pilin ComGD -
  V6D45_RS12565 (V6D45_12570) comGC 2481481..2481777 (-) 297 WP_014114400.1 comG operon protein ComGC Machinery gene
  V6D45_RS12570 (V6D45_12575) comGB 2481791..2482828 (-) 1038 WP_338442838.1 competence type IV pilus assembly protein ComGB Machinery gene
  V6D45_RS12575 (V6D45_12580) comGA 2482815..2483885 (-) 1071 WP_268393875.1 competence protein ComGA Machinery gene
  V6D45_RS12580 (V6D45_12585) - 2484099..2484509 (-) 411 WP_338442839.1 CBS domain-containing protein -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14328.47 Da        Isoelectric Point: 9.2402

>NTDB_id=939682 V6D45_RS12545 WP_268393879.1 2479945..2480319(-) (comGG) [Bacillus spizizenii strain kcgeb_S11]
MDSTKGFIYPAVLFVSALVLLIVNFTAAQYISRCMFEKETKEFYTGENLLQNGALLSIRHVLEQRKGQKDSQQFPYGQVS
YYIYDTSIKEQKEINLKALTKSGTERTAQIVFDQKQKKLLSWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=939682 V6D45_RS12545 WP_268393879.1 2479945..2480319(-) (comGG) [Bacillus spizizenii strain kcgeb_S11]
ATGGACAGCACGAAAGGGTTTATTTATCCCGCTGTTCTTTTTGTGTCCGCGCTTGTGCTGCTGATCGTGAACTTTACTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTTTACACAGGAGAGAATTTGCTTCAGAATGGCG
CGCTTCTGTCAATTCGGCATGTTCTTGAGCAGCGGAAAGGCCAAAAGGATTCACAGCAGTTTCCATATGGGCAGGTTTCT
TATTACATTTACGATACATCGATAAAAGAGCAAAAAGAAATCAACCTAAAAGCGTTGACGAAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGCTGGACAGAATAG

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

84.677

100

0.847