Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   V6D45_RS12510 Genome accession   NZ_CP145722
Coordinates   2476254..2476427 (+) Length   57 a.a.
NCBI ID   WP_338442836.1    Uniprot ID   -
Organism   Bacillus spizizenii strain kcgeb_S11     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2471254..2481427
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6D45_RS12495 (V6D45_12500) gcvT 2472050..2473138 (-) 1089 WP_338442834.1 glycine cleavage system aminomethyltransferase GcvT -
  V6D45_RS12500 (V6D45_12505) - 2473580..2475253 (+) 1674 WP_338442835.1 SNF2-related protein -
  V6D45_RS12505 (V6D45_12510) - 2475274..2476068 (+) 795 WP_268392645.1 YqhG family protein -
  V6D45_RS12510 (V6D45_12515) sinI 2476254..2476427 (+) 174 WP_338442836.1 anti-repressor SinI family protein Regulator
  V6D45_RS12515 (V6D45_12520) sinR 2476461..2476796 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  V6D45_RS12520 (V6D45_12525) tasA 2476890..2477675 (-) 786 WP_014114390.1 biofilm matrix protein TasA -
  V6D45_RS12525 (V6D45_12530) - 2477739..2478311 (-) 573 WP_338444517.1 signal peptidase I -
  V6D45_RS12530 (V6D45_12535) tapA 2478295..2479056 (-) 762 WP_338442837.1 amyloid fiber anchoring/assembly protein TapA -
  V6D45_RS12535 (V6D45_12540) - 2479326..2479652 (+) 327 WP_268393880.1 YqzG/YhdC family protein -
  V6D45_RS12540 (V6D45_12545) - 2479694..2479873 (-) 180 WP_003226330.1 YqzE family protein -
  V6D45_RS12545 (V6D45_12550) comGG 2479945..2480319 (-) 375 WP_268393879.1 competence type IV pilus minor pilin ComGG Machinery gene
  V6D45_RS12550 (V6D45_12555) comGF 2480320..2480703 (-) 384 WP_268393878.1 competence type IV pilus minor pilin ComGF Machinery gene
  V6D45_RS12555 (V6D45_12560) comGE 2480729..2481076 (-) 348 WP_268393877.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6604.58 Da        Isoelectric Point: 7.3180

>NTDB_id=939680 V6D45_RS12510 WP_338442836.1 2476254..2476427(+) (sinI) [Bacillus spizizenii strain kcgeb_S11]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIQKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=939680 V6D45_RS12510 WP_338442836.1 2476254..2476427(+) (sinI) [Bacillus spizizenii strain kcgeb_S11]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACAAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

94.737

100

0.947