Detailed information    

insolico Bioinformatically predicted

Overview


Name   dprA   Type   Machinery gene
Locus tag   V6C67_RS07945 Genome accession   NZ_CP145238
Coordinates   1604471..1605343 (-) Length   290 a.a.
NCBI ID   WP_023350397.1    Uniprot ID   -
Organism   Staphylococcus capitis subsp. urealyticus strain Sc1365674     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1559176..1622692 1604471..1605343 within 0


Gene organization within MGE regions


Location: 1559176..1622692
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6C67_RS07765 (V6C67_07760) recA 1560737..1561789 (-) 1053 WP_023350375.1 recombinase RecA Machinery gene
  V6C67_RS07770 (V6C67_07765) - 1561958..1563106 (-) 1149 WP_023350376.1 CinA family nicotinamide mononucleotide deamidase-related protein -
  V6C67_RS07775 (V6C67_07770) pgsA 1563249..1563830 (-) 582 WP_023350377.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  V6C67_RS07780 (V6C67_07775) - 1563858..1564250 (-) 393 WP_002436354.1 helix-turn-helix domain-containing protein -
  V6C67_RS07785 (V6C67_07780) - 1564269..1565096 (-) 828 WP_002436330.1 YmfK family protein -
  V6C67_RS07790 (V6C67_07785) - 1565255..1565962 (-) 708 WP_023350378.1 SDR family NAD(P)-dependent oxidoreductase -
  V6C67_RS07795 (V6C67_07790) - 1565962..1567248 (-) 1287 WP_023350379.1 pitrilysin family protein -
  V6C67_RS07800 (V6C67_07795) - 1567248..1568522 (-) 1275 WP_023350380.1 pitrilysin family protein -
  V6C67_RS07805 (V6C67_07800) - 1568564..1569274 (-) 711 WP_023350381.1 GntR family transcriptional regulator -
  V6C67_RS07810 (V6C67_07805) - 1569277..1571697 (-) 2421 WP_023350382.1 DNA translocase FtsK -
  V6C67_RS07815 (V6C67_07810) - 1571955..1573628 (-) 1674 WP_002469869.1 ribonuclease J -
  V6C67_RS07820 (V6C67_07815) pnp 1573862..1575961 (-) 2100 WP_367112169.1 polyribonucleotide nucleotidyltransferase -
  V6C67_RS07825 (V6C67_07820) rpsO 1576095..1576364 (-) 270 WP_002436359.1 30S ribosomal protein S15 -
  V6C67_RS07830 (V6C67_07825) ribF 1576486..1577457 (-) 972 WP_002436322.1 riboflavin biosynthesis protein RibF -
  V6C67_RS07835 (V6C67_07830) truB 1577473..1578390 (-) 918 WP_023350385.1 tRNA pseudouridine(55) synthase TruB -
  V6C67_RS07840 (V6C67_07835) rbfA 1578539..1578889 (-) 351 WP_002436301.1 30S ribosome-binding factor RbfA -
  V6C67_RS07845 (V6C67_07840) infB 1579046..1581220 (-) 2175 WP_023350386.1 translation initiation factor IF-2 -
  V6C67_RS07850 (V6C67_07845) - 1581225..1581542 (-) 318 WP_002436350.1 ribosomal L7Ae/L30e/S12e/Gadd45 family protein -
  V6C67_RS07855 (V6C67_07850) - 1581539..1581823 (-) 285 WP_002436310.1 YlxR family protein -
  V6C67_RS07860 (V6C67_07855) nusA 1581840..1583063 (-) 1224 WP_002436342.1 transcription termination factor NusA -
  V6C67_RS07865 (V6C67_07860) rimP 1583084..1583551 (-) 468 WP_002436317.1 ribosome maturation factor RimP -
  V6C67_RS07870 (V6C67_07865) - 1583776..1588086 (-) 4311 WP_087671603.1 PolC-type DNA polymerase III -
  V6C67_RS07875 (V6C67_07870) - 1588342..1590045 (-) 1704 WP_049326556.1 proline--tRNA ligase -
  V6C67_RS07880 (V6C67_07875) rseP 1590065..1591351 (-) 1287 WP_367112170.1 RIP metalloprotease RseP -
  V6C67_RS07885 (V6C67_07880) - 1591591..1592373 (-) 783 WP_002436308.1 phosphatidate cytidylyltransferase -
  V6C67_RS07890 (V6C67_07885) - 1592377..1593147 (-) 771 WP_023350390.1 isoprenyl transferase -
  V6C67_RS07895 (V6C67_07890) frr 1593428..1593982 (-) 555 WP_002436295.1 ribosome recycling factor -
  V6C67_RS07900 (V6C67_07895) pyrH 1593999..1594721 (-) 723 WP_002436299.1 UMP kinase -
  V6C67_RS07905 (V6C67_07900) tsf 1594858..1595736 (-) 879 WP_030064793.1 translation elongation factor Ts -
  V6C67_RS07910 (V6C67_07905) rpsB 1595887..1596675 (-) 789 WP_002436327.1 30S ribosomal protein S2 -
  V6C67_RS07915 (V6C67_07910) codY 1596929..1597702 (-) 774 WP_002436324.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  V6C67_RS07920 (V6C67_07915) hslU 1597725..1599128 (-) 1404 WP_023350392.1 ATP-dependent protease ATPase subunit HslU -
  V6C67_RS07925 (V6C67_07920) hslV 1599212..1599754 (-) 543 WP_023350393.1 ATP-dependent protease subunit HslV -
  V6C67_RS07930 (V6C67_07925) xerC 1599758..1600648 (-) 891 WP_023350394.1 tyrosine recombinase XerC -
  V6C67_RS07935 (V6C67_07930) trmFO 1600885..1602192 (-) 1308 WP_023350395.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  V6C67_RS07940 (V6C67_07935) topA 1602218..1604293 (-) 2076 WP_030064789.1 type I DNA topoisomerase -
  V6C67_RS07945 (V6C67_07940) dprA 1604471..1605343 (-) 873 WP_023350397.1 DNA-processing protein DprA Machinery gene
  V6C67_RS07950 (V6C67_07945) sucD 1605569..1606477 (-) 909 WP_002436344.1 succinate--CoA ligase subunit alpha -
  V6C67_RS07955 (V6C67_07950) sucC 1606499..1607665 (-) 1167 WP_002436291.1 ADP-forming succinate--CoA ligase subunit beta -
  V6C67_RS07960 (V6C67_07955) - 1607773..1608543 (-) 771 WP_023350398.1 ribonuclease HII -
  V6C67_RS07965 (V6C67_07960) ylqF 1608527..1609410 (-) 884 Protein_1510 ribosome biogenesis GTPase YlqF -
  V6C67_RS07970 (V6C67_07965) - 1609690..1612290 (+) 2601 WP_023350400.1 YfhO family protein -
  V6C67_RS07975 (V6C67_07970) - 1612283..1614889 (+) 2607 WP_023350401.1 YfhO family protein -
  V6C67_RS07980 (V6C67_07975) - 1615369..1615575 (+) 207 WP_226859621.1 hypothetical protein -
  V6C67_RS07985 (V6C67_07980) - 1615615..1615953 (+) 339 WP_023350404.1 hypothetical protein -
  V6C67_RS07990 (V6C67_07985) rplS 1616530..1616880 (-) 351 WP_002436293.1 50S ribosomal protein L19 -
  V6C67_RS07995 (V6C67_07990) trmD 1616986..1617723 (-) 738 WP_023350405.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  V6C67_RS08000 (V6C67_07995) rimM 1617723..1618226 (-) 504 WP_023350406.1 ribosome maturation factor RimM -
  V6C67_RS08005 (V6C67_08000) rpsP 1618489..1618764 (-) 276 WP_002453071.1 30S ribosomal protein S16 -
  V6C67_RS08010 (V6C67_08005) ffh 1619192..1620559 (-) 1368 WP_002435148.1 signal recognition particle protein -
  V6C67_RS08015 (V6C67_08010) - 1620589..1620921 (-) 333 WP_002435170.1 putative DNA-binding protein -
  V6C67_RS08020 (V6C67_08015) ftsY 1620908..1622167 (-) 1260 WP_023350407.1 signal recognition particle-docking protein FtsY -

Sequence


Protein


Download         Length: 290 a.a.        Molecular weight: 33411.79 Da        Isoelectric Point: 9.7513

>NTDB_id=938082 V6C67_RS07945 WP_023350397.1 1604471..1605343(-) (dprA) [Staphylococcus capitis subsp. urealyticus strain Sc1365674]
MIQHTLLKLYWANFATTQVHQFIKEYPEVISENALIQNKMIEDWAKRQTSSTVRRKLSLFKSLNTEVIFQEMTKMNLKYL
TYFDKHYPQLLKEIYDFPYVIFYKGNKQLFNCPHTLAVIGSRKSTLYTTQALEYLFPSFKSLKMTIISGLAYGADSIAHQ
VALKNKLPTIGVLGFGHSYHYPKSSLKTRENIERKGLVISEYPPHSPITRYKFPERNRLISGLARGLLITEAEKISGSQI
TVDCALEQNRNVYVLPGSMFNPMTKSNLLRLQEGAQVVLDECSILSDYIF

Nucleotide


Download         Length: 873 bp        

>NTDB_id=938082 V6C67_RS07945 WP_023350397.1 1604471..1605343(-) (dprA) [Staphylococcus capitis subsp. urealyticus strain Sc1365674]
GTGATTCAACACACTTTATTGAAGCTCTATTGGGCTAATTTCGCCACAACGCAAGTTCATCAATTTATTAAAGAATATCC
AGAAGTTATTTCAGAAAACGCACTAATTCAAAATAAGATGATTGAGGATTGGGCTAAAAGACAAACCTCATCCACAGTCA
GGAGAAAATTGAGCTTATTTAAATCACTTAATACAGAAGTTATATTTCAAGAAATGACTAAAATGAACCTCAAATATTTA
ACTTACTTTGATAAACATTATCCTCAATTACTTAAAGAAATTTATGATTTCCCATATGTAATTTTTTATAAAGGAAATAA
ACAACTATTTAATTGTCCTCATACTTTAGCTGTTATAGGCTCAAGAAAGTCAACCTTATATACAACTCAAGCTTTGGAAT
ATCTTTTCCCATCATTTAAATCACTAAAAATGACGATTATTTCAGGATTAGCATATGGTGCAGATAGTATAGCTCACCAA
GTCGCACTAAAAAATAAACTTCCAACAATAGGCGTTCTTGGCTTCGGCCATTCATATCATTATCCTAAATCATCTTTAAA
GACAAGAGAGAATATCGAACGAAAAGGACTAGTTATAAGTGAGTATCCACCTCATTCTCCCATAACCAGATATAAATTTC
CTGAAAGAAATAGATTGATTAGTGGACTCGCTCGGGGTCTATTAATTACAGAAGCAGAGAAAATAAGCGGTAGTCAAATA
ACAGTAGACTGCGCTTTAGAACAAAACCGGAATGTATATGTTTTACCAGGATCAATGTTTAATCCTATGACCAAAAGTAA
TTTACTTAGACTTCAAGAGGGGGCACAAGTCGTTTTAGATGAATGTAGTATTCTTTCAGACTACATTTTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus N315

59.028

99.31

0.586

  dprA Staphylococcus aureus MW2

59.028

99.31

0.586