Detailed information    

insolico Bioinformatically predicted

Overview


Name   dprA   Type   Machinery gene
Locus tag   V6C68_RS08230 Genome accession   NZ_CP145228
Coordinates   1706436..1707308 (-) Length   290 a.a.
NCBI ID   WP_023350397.1    Uniprot ID   -
Organism   Staphylococcus capitis subsp. urealyticus strain Sc1365695     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1661141..1724657 1706436..1707308 within 0


Gene organization within MGE regions


Location: 1661141..1724657
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V6C68_RS08050 (V6C68_08040) recA 1662702..1663754 (-) 1053 WP_023350375.1 recombinase RecA Machinery gene
  V6C68_RS08055 (V6C68_08045) - 1663923..1665071 (-) 1149 WP_023350376.1 CinA family nicotinamide mononucleotide deamidase-related protein -
  V6C68_RS08060 (V6C68_08050) pgsA 1665214..1665795 (-) 582 WP_023350377.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  V6C68_RS08065 (V6C68_08055) - 1665823..1666215 (-) 393 WP_002436354.1 helix-turn-helix domain-containing protein -
  V6C68_RS08070 (V6C68_08060) - 1666234..1667061 (-) 828 WP_002436330.1 YmfK family protein -
  V6C68_RS08075 (V6C68_08065) - 1667220..1667927 (-) 708 WP_023350378.1 SDR family NAD(P)-dependent oxidoreductase -
  V6C68_RS08080 (V6C68_08070) - 1667927..1669213 (-) 1287 WP_023350379.1 pitrilysin family protein -
  V6C68_RS08085 (V6C68_08075) - 1669213..1670487 (-) 1275 WP_023350380.1 pitrilysin family protein -
  V6C68_RS08090 (V6C68_08080) - 1670529..1671239 (-) 711 WP_023350381.1 GntR family transcriptional regulator -
  V6C68_RS08095 (V6C68_08085) - 1671242..1673662 (-) 2421 WP_023350382.1 DNA translocase FtsK -
  V6C68_RS08100 (V6C68_08090) - 1673920..1675593 (-) 1674 WP_002469869.1 ribonuclease J -
  V6C68_RS08105 (V6C68_08095) pnp 1675827..1677926 (-) 2100 WP_023350384.1 polyribonucleotide nucleotidyltransferase -
  V6C68_RS08110 (V6C68_08100) rpsO 1678060..1678329 (-) 270 WP_002436359.1 30S ribosomal protein S15 -
  V6C68_RS08115 (V6C68_08105) ribF 1678451..1679422 (-) 972 WP_002436322.1 riboflavin biosynthesis protein RibF -
  V6C68_RS08120 (V6C68_08110) truB 1679438..1680355 (-) 918 WP_023350385.1 tRNA pseudouridine(55) synthase TruB -
  V6C68_RS08125 (V6C68_08115) rbfA 1680504..1680854 (-) 351 WP_002436301.1 30S ribosome-binding factor RbfA -
  V6C68_RS08130 (V6C68_08120) infB 1681011..1683185 (-) 2175 WP_023350386.1 translation initiation factor IF-2 -
  V6C68_RS08135 (V6C68_08125) - 1683190..1683507 (-) 318 WP_002436350.1 ribosomal L7Ae/L30e/S12e/Gadd45 family protein -
  V6C68_RS08140 (V6C68_08130) - 1683504..1683788 (-) 285 WP_002436310.1 YlxR family protein -
  V6C68_RS08145 (V6C68_08135) nusA 1683805..1685028 (-) 1224 WP_002436342.1 transcription termination factor NusA -
  V6C68_RS08150 (V6C68_08140) rimP 1685049..1685516 (-) 468 WP_002436317.1 ribosome maturation factor RimP -
  V6C68_RS08155 (V6C68_08145) - 1685741..1690051 (-) 4311 WP_087671603.1 PolC-type DNA polymerase III -
  V6C68_RS08160 (V6C68_08150) - 1690307..1692010 (-) 1704 WP_049326556.1 proline--tRNA ligase -
  V6C68_RS08165 (V6C68_08155) rseP 1692030..1693316 (-) 1287 WP_023350389.1 RIP metalloprotease RseP -
  V6C68_RS08170 (V6C68_08160) - 1693556..1694338 (-) 783 WP_002436308.1 phosphatidate cytidylyltransferase -
  V6C68_RS08175 (V6C68_08165) - 1694342..1695112 (-) 771 WP_023350390.1 isoprenyl transferase -
  V6C68_RS08180 (V6C68_08170) frr 1695393..1695947 (-) 555 WP_002436295.1 ribosome recycling factor -
  V6C68_RS08185 (V6C68_08175) pyrH 1695964..1696686 (-) 723 WP_002436299.1 UMP kinase -
  V6C68_RS08190 (V6C68_08180) tsf 1696823..1697701 (-) 879 WP_030064793.1 translation elongation factor Ts -
  V6C68_RS08195 (V6C68_08185) rpsB 1697852..1698640 (-) 789 WP_002436327.1 30S ribosomal protein S2 -
  V6C68_RS08200 (V6C68_08190) codY 1698894..1699667 (-) 774 WP_002436324.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  V6C68_RS08205 (V6C68_08195) hslU 1699690..1701093 (-) 1404 WP_023350392.1 ATP-dependent protease ATPase subunit HslU -
  V6C68_RS08210 (V6C68_08200) hslV 1701177..1701719 (-) 543 WP_023350393.1 ATP-dependent protease subunit HslV -
  V6C68_RS08215 (V6C68_08205) xerC 1701723..1702613 (-) 891 WP_023350394.1 tyrosine recombinase XerC -
  V6C68_RS08220 (V6C68_08210) trmFO 1702850..1704157 (-) 1308 WP_367027648.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  V6C68_RS08225 (V6C68_08215) topA 1704183..1706258 (-) 2076 WP_030064789.1 type I DNA topoisomerase -
  V6C68_RS08230 (V6C68_08220) dprA 1706436..1707308 (-) 873 WP_023350397.1 DNA-processing protein DprA Machinery gene
  V6C68_RS08235 (V6C68_08225) sucD 1707534..1708442 (-) 909 WP_002436344.1 succinate--CoA ligase subunit alpha -
  V6C68_RS08240 (V6C68_08230) sucC 1708464..1709630 (-) 1167 WP_002436291.1 ADP-forming succinate--CoA ligase subunit beta -
  V6C68_RS08245 (V6C68_08235) - 1709738..1710508 (-) 771 WP_023350398.1 ribonuclease HII -
  V6C68_RS08250 (V6C68_08240) ylqF 1710492..1711375 (-) 884 Protein_1586 ribosome biogenesis GTPase YlqF -
  V6C68_RS08255 (V6C68_08245) - 1711655..1714255 (+) 2601 WP_023350400.1 YfhO family protein -
  V6C68_RS08260 (V6C68_08250) - 1714248..1716854 (+) 2607 WP_023350401.1 YfhO family protein -
  V6C68_RS08265 (V6C68_08255) - 1717301..1717540 (+) 240 WP_228071818.1 hypothetical protein -
  V6C68_RS08270 (V6C68_08260) - 1717580..1717918 (+) 339 WP_023350404.1 hypothetical protein -
  V6C68_RS08275 (V6C68_08265) rplS 1718495..1718845 (-) 351 WP_002436293.1 50S ribosomal protein L19 -
  V6C68_RS08280 (V6C68_08270) trmD 1718951..1719688 (-) 738 WP_194380088.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  V6C68_RS08285 (V6C68_08275) rimM 1719688..1720191 (-) 504 WP_023350406.1 ribosome maturation factor RimM -
  V6C68_RS08290 (V6C68_08280) rpsP 1720454..1720729 (-) 276 WP_002453071.1 30S ribosomal protein S16 -
  V6C68_RS08295 (V6C68_08285) ffh 1721157..1722524 (-) 1368 WP_002435148.1 signal recognition particle protein -
  V6C68_RS08300 (V6C68_08290) - 1722554..1722886 (-) 333 WP_002435170.1 putative DNA-binding protein -
  V6C68_RS08305 (V6C68_08295) ftsY 1722873..1724132 (-) 1260 WP_023350407.1 signal recognition particle-docking protein FtsY -

Sequence


Protein


Download         Length: 290 a.a.        Molecular weight: 33411.79 Da        Isoelectric Point: 9.7513

>NTDB_id=937976 V6C68_RS08230 WP_023350397.1 1706436..1707308(-) (dprA) [Staphylococcus capitis subsp. urealyticus strain Sc1365695]
MIQHTLLKLYWANFATTQVHQFIKEYPEVISENALIQNKMIEDWAKRQTSSTVRRKLSLFKSLNTEVIFQEMTKMNLKYL
TYFDKHYPQLLKEIYDFPYVIFYKGNKQLFNCPHTLAVIGSRKSTLYTTQALEYLFPSFKSLKMTIISGLAYGADSIAHQ
VALKNKLPTIGVLGFGHSYHYPKSSLKTRENIERKGLVISEYPPHSPITRYKFPERNRLISGLARGLLITEAEKISGSQI
TVDCALEQNRNVYVLPGSMFNPMTKSNLLRLQEGAQVVLDECSILSDYIF

Nucleotide


Download         Length: 873 bp        

>NTDB_id=937976 V6C68_RS08230 WP_023350397.1 1706436..1707308(-) (dprA) [Staphylococcus capitis subsp. urealyticus strain Sc1365695]
GTGATTCAACACACTTTATTGAAGCTCTATTGGGCTAATTTCGCCACAACGCAAGTTCATCAATTTATTAAAGAATATCC
AGAAGTTATTTCAGAAAACGCACTAATTCAAAATAAGATGATTGAGGATTGGGCTAAAAGACAAACCTCATCCACAGTCA
GGAGAAAATTGAGCTTATTTAAATCACTTAATACAGAAGTTATATTTCAAGAAATGACTAAAATGAACCTCAAATATTTA
ACTTACTTTGATAAACATTATCCTCAATTACTTAAAGAAATTTATGATTTCCCATATGTAATTTTTTATAAAGGAAATAA
ACAACTATTTAATTGTCCTCATACTTTAGCTGTTATAGGCTCAAGAAAGTCAACCTTATATACAACTCAAGCTTTGGAAT
ATCTTTTCCCATCATTTAAATCACTAAAAATGACGATTATTTCAGGATTAGCATATGGTGCAGATAGTATAGCTCACCAA
GTCGCACTAAAAAATAAACTTCCAACAATAGGCGTTCTTGGCTTCGGCCATTCATATCATTATCCTAAATCATCTTTAAA
GACAAGAGAGAATATCGAACGAAAAGGACTAGTTATAAGTGAGTATCCACCTCATTCTCCCATAACCAGATATAAATTTC
CTGAAAGAAATAGATTGATTAGTGGACTCGCTCGGGGTCTATTAATTACAGAAGCAGAGAAAATAAGCGGTAGTCAAATA
ACAGTAGACTGCGCTTTAGAACAAAACCGGAATGTATATGTTTTACCAGGATCAATGTTTAATCCTATGACCAAAAGTAA
TTTACTTAGACTTCAAGAGGGGGCACAAGTCGTTTTAGATGAATGTAGTATTCTTTCAGACTACATTTTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus N315

59.028

99.31

0.586

  dprA Staphylococcus aureus MW2

59.028

99.31

0.586