Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   V5F86_RS15880 Genome accession   NZ_CP145137
Coordinates   3114291..3114431 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus spizizenii strain kcgeb_sc     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3109291..3119431
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V5F86_RS15855 (V5F86_15860) - 3109609..3109989 (-) 381 WP_003220719.1 hotdog fold thioesterase -
  V5F86_RS15860 (V5F86_15865) comA 3110006..3110650 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  V5F86_RS15865 (V5F86_15870) comP 3110731..3113037 (-) 2307 WP_268392280.1 two-component system sensor histidine kinase ComP Regulator
  V5F86_RS15870 (V5F86_15875) comX 3113052..3113225 (-) 174 WP_268392278.1 competence pheromone ComX -
  V5F86_RS15875 (V5F86_15880) comQ 3113240..3114106 (-) 867 WP_268392274.1 polyprenyl synthetase family protein Regulator
  V5F86_RS15880 (V5F86_15885) degQ 3114291..3114431 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  V5F86_RS15885 (V5F86_15890) - 3114653..3114778 (+) 126 WP_014114985.1 hypothetical protein -
  V5F86_RS15890 (V5F86_15895) - 3114893..3115261 (+) 369 WP_268454380.1 hypothetical protein -
  V5F86_RS15895 (V5F86_15900) pdeH 3115237..3116466 (-) 1230 WP_338443149.1 cyclic di-GMP phosphodiesterase -
  V5F86_RS15900 (V5F86_15905) - 3116602..3118074 (-) 1473 WP_268454377.1 nicotinate phosphoribosyltransferase -
  V5F86_RS15905 (V5F86_15910) - 3118090..3118641 (-) 552 WP_087987471.1 isochorismatase family cysteine hydrolase -
  V5F86_RS15910 (V5F86_15915) - 3118738..3119136 (-) 399 WP_268392264.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=937441 V5F86_RS15880 WP_003220708.1 3114291..3114431(-) (degQ) [Bacillus spizizenii strain kcgeb_sc]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=937441 V5F86_RS15880 WP_003220708.1 3114291..3114431(-) (degQ) [Bacillus spizizenii strain kcgeb_sc]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTACGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1