Detailed information
Bioinformatically predicted
Overview
| Name | comP | Type | Machinery gene |
| Locus tag | V5F91_RS07950 | Genome accession | NZ_CP145064 |
| Coordinates | 1532198..1532647 (-) | Length | 149 a.a. |
| NCBI ID | WP_002214937.1 | Uniprot ID | A0AA44U8B7 |
| Organism | Neisseria gonorrhoeae strain WHO_S_2024 | ||
| Function | DNA binding; DNA uptake; receptor of DNA uptake sequence (DUS) (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1497799..1531949 | 1532198..1532647 | flank | 249 |
Gene organization within MGE regions
Location: 1497799..1532647
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V5F91_RS07680 (V5F91_07700) | - | 1497827..1498801 (-) | 975 | WP_003689550.1 | SIS domain-containing protein | - |
| V5F91_RS07685 (V5F91_07705) | tal | 1498898..1499953 (+) | 1056 | WP_353174116.1 | transaldolase | - |
| V5F91_RS07690 (V5F91_07710) | - | 1499965..1500099 (+) | 135 | WP_003703570.1 | hypothetical protein | - |
| V5F91_RS07695 (V5F91_07715) | - | 1500104..1500394 (+) | 291 | WP_003689553.1 | hypothetical protein | - |
| V5F91_RS07700 (V5F91_07720) | gluQRS | 1500411..1501298 (+) | 888 | WP_003689554.1 | tRNA glutamyl-Q(34) synthetase GluQRS | - |
| V5F91_RS07705 (V5F91_07725) | dusA | 1501368..1502384 (-) | 1017 | WP_003689555.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| V5F91_RS07710 (V5F91_07730) | - | 1502504..1503658 (+) | 1155 | WP_003693486.1 | tyrosine-type recombinase/integrase | - |
| V5F91_RS07715 (V5F91_07735) | - | 1503708..1503974 (-) | 267 | WP_003689557.1 | pyocin activator PrtN family protein | - |
| V5F91_RS07720 (V5F91_07740) | - | 1504082..1505230 (-) | 1149 | WP_115176891.1 | SAM-dependent methyltransferase | - |
| V5F91_RS07725 (V5F91_07745) | - | 1505227..1506210 (-) | 984 | WP_041421310.1 | phage associated protein | - |
| V5F91_RS07730 (V5F91_07750) | - | 1506321..1506536 (-) | 216 | WP_082285068.1 | hypothetical protein | - |
| V5F91_RS07735 (V5F91_07755) | - | 1506588..1507079 (-) | 492 | WP_071200672.1 | siphovirus Gp157 family protein | - |
| V5F91_RS07740 (V5F91_07760) | - | 1507076..1507258 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| V5F91_RS07745 (V5F91_07765) | - | 1507398..1508084 (-) | 687 | WP_042758540.1 | phage replication initiation protein, NGO0469 family | - |
| V5F91_RS07750 (V5F91_07770) | - | 1508153..1508314 (-) | 162 | WP_003693867.1 | hypothetical protein | - |
| V5F91_RS07755 (V5F91_07775) | - | 1508311..1508586 (-) | 276 | WP_353174121.1 | NGO1622 family putative holin | - |
| V5F91_RS07760 (V5F91_07780) | - | 1508739..1509071 (-) | 333 | WP_033910331.1 | phage associated protein | - |
| V5F91_RS07765 (V5F91_07785) | - | 1509212..1509412 (-) | 201 | WP_003695499.1 | hypothetical protein | - |
| V5F91_RS07770 (V5F91_07790) | - | 1509622..1510383 (+) | 762 | WP_012503753.1 | hypothetical protein | - |
| V5F91_RS07775 (V5F91_07795) | - | 1510472..1510888 (-) | 417 | WP_003700378.1 | hypothetical protein | - |
| V5F91_RS07780 (V5F91_07800) | - | 1510897..1511481 (-) | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| V5F91_RS07785 (V5F91_07805) | - | 1511663..1512064 (-) | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| V5F91_RS07790 (V5F91_07810) | - | 1512166..1512348 (-) | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | - |
| V5F91_RS07795 (V5F91_07815) | - | 1512518..1513336 (-) | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| V5F91_RS07800 (V5F91_07820) | - | 1513611..1514366 (-) | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| V5F91_RS07805 (V5F91_07825) | - | 1514503..1514688 (+) | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| V5F91_RS07810 (V5F91_07830) | - | 1514777..1514932 (+) | 156 | WP_003698902.1 | hypothetical protein | - |
| V5F91_RS07815 (V5F91_07835) | - | 1514909..1515097 (-) | 189 | WP_003691445.1 | hypothetical protein | - |
| V5F91_RS07820 (V5F91_07840) | - | 1515271..1515498 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| V5F91_RS07825 (V5F91_07845) | - | 1515616..1516680 (+) | 1065 | WP_106337065.1 | hypothetical protein | - |
| V5F91_RS07830 (V5F91_07850) | - | 1516677..1518038 (+) | 1362 | WP_003706450.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| V5F91_RS07835 (V5F91_07855) | - | 1518055..1518285 (+) | 231 | WP_353174126.1 | hypothetical protein | - |
| V5F91_RS07840 (V5F91_07860) | - | 1518376..1518870 (+) | 495 | WP_033911193.1 | DUF3310 domain-containing protein | - |
| V5F91_RS07845 (V5F91_07865) | - | 1519201..1519350 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| V5F91_RS07850 (V5F91_07870) | - | 1519378..1519647 (+) | 270 | WP_047921130.1 | hypothetical protein | - |
| V5F91_RS07855 (V5F91_07875) | - | 1519638..1520018 (+) | 381 | WP_033911195.1 | RusA family crossover junction endodeoxyribonuclease | - |
| V5F91_RS07860 (V5F91_07880) | - | 1520035..1520163 (-) | 129 | WP_012503747.1 | hypothetical protein | - |
| V5F91_RS07865 (V5F91_07885) | - | 1520347..1521309 (-) | 963 | WP_050170924.1 | IS110 family transposase | - |
| V5F91_RS07870 (V5F91_07890) | - | 1521840..1522199 (-) | 360 | WP_003691563.1 | hypothetical protein | - |
| V5F91_RS07875 (V5F91_07895) | - | 1522320..1523392 (-) | 1073 | Protein_1540 | zonular occludens toxin domain-containing protein | - |
| V5F91_RS07880 (V5F91_07900) | - | 1523402..1523692 (-) | 291 | WP_012503936.1 | DUF2523 domain-containing protein | - |
| V5F91_RS07885 (V5F91_07905) | - | 1523671..1525260 (-) | 1590 | WP_353174013.1 | IgG-binding virulence factor TspB family protein | - |
| V5F91_RS07890 (V5F91_07910) | - | 1525202..1525519 (-) | 318 | WP_003696077.1 | DUF1132 family protein | - |
| V5F91_RS07895 (V5F91_07915) | - | 1525647..1525925 (-) | 279 | WP_003691583.1 | hypothetical protein | - |
| V5F91_RS07900 (V5F91_07920) | - | 1525932..1526150 (-) | 219 | WP_003691584.1 | major capsid protein | - |
| V5F91_RS07905 (V5F91_07925) | - | 1526224..1526421 (-) | 198 | WP_003689600.1 | hypothetical protein | - |
| V5F91_RS07910 (V5F91_07930) | - | 1526426..1526716 (-) | 291 | WP_012503914.1 | hypothetical protein | - |
| V5F91_RS07915 (V5F91_07935) | - | 1526761..1528107 (-) | 1347 | WP_169335288.1 | replication initiation factor domain-containing protein | - |
| V5F91_RS07920 (V5F91_07940) | - | 1528245..1528667 (-) | 423 | WP_003691751.1 | very short patch repair endonuclease | - |
| V5F91_RS07925 (V5F91_07945) | - | 1528673..1529269 (-) | 597 | WP_012503916.1 | TIGR02391 family protein | - |
| V5F91_RS07930 (V5F91_07950) | - | 1529459..1530316 (-) | 858 | WP_012503917.1 | ATP-binding protein | - |
| V5F91_RS07935 (V5F91_07955) | - | 1530330..1530764 (-) | 435 | WP_229684538.1 | DNA cytosine methyltransferase | - |
| V5F91_RS07940 (V5F91_07960) | - | 1530698..1531306 (-) | 609 | WP_080229275.1 | DNA cytosine methyltransferase | - |
| V5F91_RS07945 (V5F91_07965) | - | 1531675..1531821 (+) | 147 | WP_003691757.1 | hypothetical protein | - |
| V5F91_RS07950 (V5F91_07970) | comP | 1532198..1532647 (-) | 450 | WP_002214937.1 | type IV pilin protein | Machinery gene |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 16834.81 Da Isoelectric Point: 9.7951
>NTDB_id=936763 V5F91_RS07950 WP_002214937.1 1532198..1532647(-) (comP) [Neisseria gonorrhoeae strain WHO_S_2024]
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK
Nucleotide
Download Length: 450 bp
>NTDB_id=936763 V5F91_RS07950 WP_002214937.1 1532198..1532647(-) (comP) [Neisseria gonorrhoeae strain WHO_S_2024]
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGATTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTACTTAAGTAG
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGATTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTACTTAAGTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comP | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| comP | Neisseria meningitidis 8013 |
99.329 |
100 |
0.993 |
| comP | Neisseria subflava NJ9703 |
49.66 |
98.658 |
0.49 |