Detailed information
Bioinformatically predicted
Overview
| Name | comP | Type | Machinery gene |
| Locus tag | V5F97_RS08440 | Genome accession | NZ_CP145057 |
| Coordinates | 1622765..1623214 (-) | Length | 149 a.a. |
| NCBI ID | WP_002214937.1 | Uniprot ID | A0AA44U8B7 |
| Organism | Neisseria gonorrhoeae strain WHO_alpha_2024 | ||
| Function | DNA binding; DNA uptake; receptor of DNA uptake sequence (DUS) (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1588925..1622516 | 1622765..1623214 | flank | 249 |
Gene organization within MGE regions
Location: 1588925..1623214
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V5F97_RS08170 (V5F97_08210) | - | 1588953..1589927 (-) | 975 | WP_003689550.1 | SIS domain-containing protein | - |
| V5F97_RS08175 (V5F97_08215) | tal | 1590024..1591079 (+) | 1056 | WP_003689551.1 | transaldolase | - |
| V5F97_RS08180 (V5F97_08220) | - | 1591091..1591225 (+) | 135 | WP_012503902.1 | hypothetical protein | - |
| V5F97_RS08185 (V5F97_08225) | - | 1591230..1591520 (+) | 291 | WP_003689553.1 | hypothetical protein | - |
| V5F97_RS08190 (V5F97_08230) | gluQRS | 1591537..1592424 (+) | 888 | WP_003689554.1 | tRNA glutamyl-Q(34) synthetase GluQRS | - |
| V5F97_RS08195 (V5F97_08235) | dusA | 1592494..1593510 (-) | 1017 | WP_003689555.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| V5F97_RS08200 (V5F97_08240) | - | 1593630..1594784 (+) | 1155 | WP_047919675.1 | tyrosine-type recombinase/integrase | - |
| V5F97_RS08205 (V5F97_08245) | - | 1594834..1595100 (-) | 267 | WP_003689557.1 | pyocin activator PrtN family protein | - |
| V5F97_RS08210 (V5F97_08250) | - | 1595208..1596356 (-) | 1149 | WP_003705649.1 | hypothetical protein | - |
| V5F97_RS08215 (V5F97_08255) | - | 1596353..1597336 (-) | 984 | WP_047919745.1 | hypothetical protein | - |
| V5F97_RS08220 (V5F97_08260) | - | 1597447..1597662 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| V5F97_RS08225 (V5F97_08265) | - | 1597714..1598205 (-) | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| V5F97_RS08230 (V5F97_08270) | - | 1598202..1598384 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| V5F97_RS08235 (V5F97_08275) | - | 1598524..1599210 (-) | 687 | WP_042758540.1 | phage replication initiation protein, NGO0469 family | - |
| V5F97_RS08240 (V5F97_08280) | - | 1599279..1599440 (-) | 162 | WP_003702497.1 | hypothetical protein | - |
| V5F97_RS08245 (V5F97_08285) | - | 1599437..1599715 (-) | 279 | WP_003691529.1 | NGO1622 family putative holin | - |
| V5F97_RS08250 (V5F97_08290) | - | 1599868..1600200 (-) | 333 | WP_003687946.1 | hypothetical protein | - |
| V5F97_RS08255 (V5F97_08295) | - | 1600342..1600617 (-) | 276 | WP_047925817.1 | hypothetical protein | - |
| V5F97_RS08260 (V5F97_08300) | - | 1600614..1601090 (-) | 477 | WP_003691526.1 | hypothetical protein | - |
| V5F97_RS08265 (V5F97_08305) | - | 1601123..1601323 (-) | 201 | WP_047919800.1 | hypothetical protein | - |
| V5F97_RS08270 (V5F97_08310) | - | 1601544..1602305 (+) | 762 | WP_012503753.1 | hypothetical protein | - |
| V5F97_RS08275 (V5F97_08315) | - | 1602404..1602805 (-) | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| V5F97_RS08280 (V5F97_08320) | - | 1602907..1603089 (-) | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | - |
| V5F97_RS08285 (V5F97_08325) | - | 1603259..1604077 (-) | 819 | WP_012503752.1 | DUF3037 domain-containing protein | - |
| V5F97_RS08290 (V5F97_08330) | - | 1604074..1604772 (-) | 699 | WP_003689139.1 | HipA family kinase | - |
| V5F97_RS08295 (V5F97_08335) | - | 1605011..1605709 (-) | 699 | WP_002212401.1 | S24 family peptidase | - |
| V5F97_RS08300 (V5F97_08340) | - | 1605749..1606435 (-) | 687 | WP_012503751.1 | helix-turn-helix transcriptional regulator | - |
| V5F97_RS08305 (V5F97_08345) | - | 1606651..1606785 (+) | 135 | WP_229684436.1 | YdaS family helix-turn-helix protein | - |
| V5F97_RS08310 (V5F97_08350) | - | 1606787..1606987 (+) | 201 | WP_012503750.1 | hypothetical protein | - |
| V5F97_RS08315 (V5F97_08355) | - | 1607184..1607990 (+) | 807 | WP_050154776.1 | replication protein | - |
| V5F97_RS08320 (V5F97_08360) | - | 1608005..1608787 (+) | 783 | WP_025456432.1 | ATP-binding protein | - |
| V5F97_RS08325 (V5F97_08365) | - | 1608800..1609063 (+) | 264 | WP_154230797.1 | hypothetical protein | - |
| V5F97_RS08330 (V5F97_08370) | - | 1609102..1609596 (+) | 495 | WP_003691434.1 | DUF3310 domain-containing protein | - |
| V5F97_RS08335 (V5F97_08375) | - | 1609773..1609922 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| V5F97_RS08340 (V5F97_08380) | - | 1609951..1610232 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| V5F97_RS08345 (V5F97_08385) | - | 1610223..1610603 (+) | 381 | WP_017147222.1 | RusA family crossover junction endodeoxyribonuclease | - |
| V5F97_RS08350 (V5F97_08390) | - | 1610620..1610748 (-) | 129 | WP_017147221.1 | hypothetical protein | - |
| V5F97_RS08355 (V5F97_08395) | - | 1610932..1611894 (-) | 963 | WP_050303398.1 | IS110 family transposase | - |
| V5F97_RS08360 (V5F97_08400) | - | 1612406..1612765 (-) | 360 | WP_003689732.1 | hypothetical protein | - |
| V5F97_RS08365 (V5F97_08405) | - | 1612886..1613958 (-) | 1073 | Protein_1634 | zonular occludens toxin domain-containing protein | - |
| V5F97_RS08370 (V5F97_08410) | - | 1613968..1614258 (-) | 291 | WP_047917922.1 | DUF2523 domain-containing protein | - |
| V5F97_RS08375 (V5F97_08415) | - | 1614237..1615826 (-) | 1590 | WP_012503913.1 | IgG-binding virulence factor TspB family protein | - |
| V5F97_RS08380 (V5F97_08420) | - | 1615768..1616085 (-) | 318 | WP_003689167.1 | DUF1132 family protein | - |
| V5F97_RS08385 (V5F97_08425) | - | 1616213..1616491 (-) | 279 | WP_003691583.1 | hypothetical protein | - |
| V5F97_RS08390 (V5F97_08430) | - | 1616498..1616716 (-) | 219 | WP_003691584.1 | major capsid protein | - |
| V5F97_RS08395 (V5F97_08435) | - | 1616790..1616987 (-) | 198 | WP_003689600.1 | hypothetical protein | - |
| V5F97_RS08400 (V5F97_08440) | - | 1616992..1617282 (-) | 291 | WP_012503914.1 | hypothetical protein | - |
| V5F97_RS08405 (V5F97_08445) | - | 1617327..1618673 (-) | 1347 | WP_082295432.1 | replication initiation factor domain-containing protein | - |
| V5F97_RS08410 (V5F97_08450) | - | 1618812..1619234 (-) | 423 | WP_003691751.1 | very short patch repair endonuclease | - |
| V5F97_RS08415 (V5F97_08455) | - | 1619240..1619836 (-) | 597 | WP_012503916.1 | TIGR02391 family protein | - |
| V5F97_RS08420 (V5F97_08460) | - | 1620026..1620883 (-) | 858 | WP_012503917.1 | ATP-binding protein | - |
| V5F97_RS08425 (V5F97_08465) | - | 1620897..1621268 (-) | 372 | WP_228841280.1 | DNA cytosine methyltransferase | - |
| V5F97_RS08430 (V5F97_08470) | - | 1621265..1621873 (-) | 609 | WP_080229275.1 | DNA cytosine methyltransferase | - |
| V5F97_RS08435 (V5F97_08475) | - | 1622242..1622388 (+) | 147 | WP_003691757.1 | hypothetical protein | - |
| V5F97_RS08440 (V5F97_08480) | comP | 1622765..1623214 (-) | 450 | WP_002214937.1 | type IV pilin protein | Machinery gene |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 16834.81 Da Isoelectric Point: 9.7951
>NTDB_id=936618 V5F97_RS08440 WP_002214937.1 1622765..1623214(-) (comP) [Neisseria gonorrhoeae strain WHO_alpha_2024]
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK
Nucleotide
Download Length: 450 bp
>NTDB_id=936618 V5F97_RS08440 WP_002214937.1 1622765..1623214(-) (comP) [Neisseria gonorrhoeae strain WHO_alpha_2024]
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGATTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTACTTAAGTAG
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGATTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTACTTAAGTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comP | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| comP | Neisseria meningitidis 8013 |
99.329 |
100 |
0.993 |
| comP | Neisseria subflava NJ9703 |
49.66 |
98.658 |
0.49 |