Detailed information    

insolico Bioinformatically predicted

Overview


Name   comP   Type   Machinery gene
Locus tag   V5G12_RS08460 Genome accession   NZ_CP145021
Coordinates   1610078..1610527 (-) Length   149 a.a.
NCBI ID   WP_002214937.1    Uniprot ID   A0AA44U8B7
Organism   Neisseria gonorrhoeae strain WHO_V_2024     
Function   DNA binding; DNA uptake; receptor of DNA uptake sequence (DUS) (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1577527..1609829 1610078..1610527 flank 249


Gene organization within MGE regions


Location: 1577527..1610527
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V5G12_RS08180 (V5G12_08195) - 1577555..1578529 (-) 975 WP_003689550.1 SIS domain-containing protein -
  V5G12_RS08185 (V5G12_08200) tal 1578626..1579681 (+) 1056 WP_003689551.1 transaldolase -
  V5G12_RS08190 (V5G12_08205) - 1579693..1579827 (+) 135 WP_012503902.1 hypothetical protein -
  V5G12_RS08195 (V5G12_08210) - 1579832..1580122 (+) 291 WP_003689553.1 hypothetical protein -
  V5G12_RS08200 (V5G12_08215) gluQRS 1580139..1581026 (+) 888 WP_003689554.1 tRNA glutamyl-Q(34) synthetase GluQRS -
  V5G12_RS08205 (V5G12_08220) dusA 1581096..1582112 (-) 1017 WP_003689555.1 tRNA dihydrouridine(20/20a) synthase DusA -
  V5G12_RS08210 (V5G12_08225) - 1582232..1583386 (+) 1155 WP_003697468.1 tyrosine-type recombinase/integrase -
  V5G12_RS08215 (V5G12_08230) - 1583436..1583702 (-) 267 WP_003689557.1 pyocin activator PrtN family protein -
  V5G12_RS08220 (V5G12_08235) - 1583810..1584061 (-) 252 WP_229687117.1 hypothetical protein -
  V5G12_RS08225 (V5G12_08240) - 1584068..1584757 (-) 690 WP_229700490.1 SAM-dependent methyltransferase -
  V5G12_RS08230 (V5G12_08245) - 1584729..1584935 (-) 207 WP_171000880.1 hypothetical protein -
  V5G12_RS08235 (V5G12_08250) - 1584932..1585915 (-) 984 WP_047952517.1 hypothetical protein -
  V5G12_RS08240 (V5G12_08255) - 1586026..1586241 (-) 216 WP_003691538.1 hypothetical protein -
  V5G12_RS08245 (V5G12_08260) - 1586293..1586784 (-) 492 WP_017147227.1 siphovirus Gp157 family protein -
  V5G12_RS08250 (V5G12_08265) - 1586781..1586963 (-) 183 WP_003691535.1 hypothetical protein -
  V5G12_RS08255 (V5G12_08270) - 1587103..1587789 (-) 687 WP_042758540.1 phage replication initiation protein, NGO0469 family -
  V5G12_RS08260 (V5G12_08275) - 1587858..1588019 (-) 162 WP_003691530.1 hypothetical protein -
  V5G12_RS08265 (V5G12_08280) - 1588016..1588291 (-) 276 WP_003703838.1 NGO1622 family putative holin -
  V5G12_RS08270 (V5G12_08285) - 1588444..1588776 (-) 333 WP_003687946.1 hypothetical protein -
  V5G12_RS08275 (V5G12_08290) - 1588917..1589204 (-) 288 WP_115095429.1 hypothetical protein -
  V5G12_RS08280 (V5G12_08295) - 1589201..1589677 (-) 477 WP_012504141.1 hypothetical protein -
  V5G12_RS08285 (V5G12_08300) - 1589710..1589910 (-) 201 WP_003692842.1 hypothetical protein -
  V5G12_RS08290 (V5G12_08305) - 1590394..1590612 (+) 219 WP_003691731.1 hypothetical protein -
  V5G12_RS08295 (V5G12_08310) - 1590629..1590988 (-) 360 WP_003691733.1 hypothetical protein -
  V5G12_RS08300 (V5G12_08315) - 1590989..1591528 (-) 540 WP_003695998.1 Panacea domain-containing protein -
  V5G12_RS08305 (V5G12_08320) - 1591688..1592392 (-) 705 WP_003702453.1 helix-turn-helix transcriptional regulator -
  V5G12_RS08310 (V5G12_08325) - 1592520..1592735 (+) 216 WP_223169978.1 helix-turn-helix transcriptional regulator -
  V5G12_RS08315 (V5G12_08330) - 1592815..1592970 (+) 156 WP_003689578.1 hypothetical protein -
  V5G12_RS08320 (V5G12_08335) - 1592947..1593135 (-) 189 WP_003706568.1 hypothetical protein -
  V5G12_RS08325 (V5G12_08340) - 1593308..1593535 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  V5G12_RS08330 (V5G12_08345) - 1593532..1593669 (+) 138 WP_010359998.1 hypothetical protein -
  V5G12_RS08335 (V5G12_08350) - 1594214..1594717 (+) 504 WP_010360005.1 hypothetical protein -
  V5G12_RS08340 (V5G12_08355) - 1594714..1596075 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  V5G12_RS08345 (V5G12_08360) - 1596092..1596322 (+) 231 WP_115095430.1 hypothetical protein -
  V5G12_RS08350 (V5G12_08365) - 1596414..1596908 (+) 495 WP_003691434.1 DUF3310 domain-containing protein -
  V5G12_RS08355 (V5G12_08370) - 1597085..1597234 (+) 150 WP_003689110.1 hypothetical protein -
  V5G12_RS08360 (V5G12_08375) - 1597262..1597543 (+) 282 WP_003689109.1 hypothetical protein -
  V5G12_RS08365 (V5G12_08380) - 1597534..1597914 (+) 381 WP_232038250.1 RusA family crossover junction endodeoxyribonuclease -
  V5G12_RS08370 (V5G12_08385) - 1597931..1598059 (-) 129 WP_017147221.1 hypothetical protein -
  V5G12_RS08375 (V5G12_08390) - 1598243..1599205 (-) 963 WP_050156280.1 IS110-like element ISNgo2 family transposase -
  V5G12_RS08380 (V5G12_08395) - 1599719..1600078 (-) 360 WP_003691563.1 hypothetical protein -
  V5G12_RS08385 (V5G12_08400) - 1600199..1601284 (-) 1086 WP_064661608.1 zonular occludens toxin domain-containing protein -
  V5G12_RS08390 (V5G12_08405) - 1601294..1601584 (-) 291 WP_012503936.1 DUF2523 domain-containing protein -
  V5G12_RS08395 (V5G12_08410) - 1601563..1603152 (-) 1590 WP_171000878.1 IgG-binding virulence factor TspB family protein -
  V5G12_RS08400 (V5G12_08415) - 1603094..1603411 (-) 318 WP_003689167.1 DUF1132 family protein -
  V5G12_RS08405 (V5G12_08420) - 1603539..1603817 (-) 279 WP_003689168.1 hypothetical protein -
  V5G12_RS08410 (V5G12_08425) - 1603824..1604042 (-) 219 WP_003691584.1 major capsid protein -
  V5G12_RS08415 (V5G12_08430) - 1604116..1604313 (-) 198 WP_003689600.1 hypothetical protein -
  V5G12_RS08420 (V5G12_08435) - 1604318..1604608 (-) 291 WP_002216601.1 hypothetical protein -
  V5G12_RS08425 (V5G12_08440) - 1604653..1605986 (-) 1334 Protein_1646 replication initiation factor domain-containing protein -
  V5G12_RS08430 (V5G12_08445) - 1606125..1606547 (-) 423 WP_003691751.1 very short patch repair endonuclease -
  V5G12_RS08435 (V5G12_08450) - 1606553..1607149 (-) 597 WP_012503916.1 TIGR02391 family protein -
  V5G12_RS08440 (V5G12_08455) - 1607339..1608196 (-) 858 WP_012503917.1 ATP-binding protein -
  V5G12_RS08445 (V5G12_08460) - 1608210..1608539 (-) 330 WP_002234365.1 DNA cytosine methyltransferase -
  V5G12_RS08450 (V5G12_08465) - 1608578..1609186 (-) 609 WP_080229275.1 DNA cytosine methyltransferase -
  V5G12_RS08455 (V5G12_08470) - 1609555..1609701 (+) 147 WP_003691757.1 hypothetical protein -
  V5G12_RS08460 (V5G12_08475) comP 1610078..1610527 (-) 450 WP_002214937.1 type IV pilin protein Machinery gene

Sequence


Protein


Download         Length: 149 a.a.        Molecular weight: 16834.81 Da        Isoelectric Point: 9.7951

>NTDB_id=935988 V5G12_RS08460 WP_002214937.1 1610078..1610527(-) (comP) [Neisseria gonorrhoeae strain WHO_V_2024]
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK

Nucleotide


Download         Length: 450 bp        

>NTDB_id=935988 V5G12_RS08460 WP_002214937.1 1610078..1610527(-) (comP) [Neisseria gonorrhoeae strain WHO_V_2024]
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGATTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTACTTAAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comP Neisseria gonorrhoeae MS11

100

100

1

  comP Neisseria meningitidis 8013

99.329

100

0.993

  comP Neisseria subflava NJ9703

49.66

98.658

0.49