Detailed information NTG0935674

Bioinformatically predicted

Overview

• Name: comGF
• Type: Machinery gene
• Locus tag: ACEPXO_RS08325
• Genome accession: NZ_CP168323
• Coordinates: 1645857..1646318 (+)
• Length: 153 a.a.
• NCBI ID: WP_001874812.1
• Uniprot ID: -
• Organism: Streptococcus agalactiae strain SA2BKE
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1640857..1651318

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACEPXO_RS08295 (ACEPXO_08295)	-	1642472..1642837 (+)	366	WP_000285373.1	DUF1033 family protein	-
ACEPXO_RS08300 (ACEPXO_08300)	comGA	1643010..1643981 (+)	972	WP_000250805.1	competence type IV pilus ATPase ComGA	Machinery gene
ACEPXO_RS08305 (ACEPXO_08305)	comGB	1643875..1644918 (+)	1044	WP_223295889.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACEPXO_RS08310 (ACEPXO_08310)	comGC/cglC	1644915..1645244 (+)	330	WP_000793380.1	competence type IV pilus major pilin ComGC	Machinery gene
ACEPXO_RS08315 (ACEPXO_08315)	comGD	1645219..1645632 (+)	414	WP_000244261.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACEPXO_RS08320 (ACEPXO_08320)	comGE	1645604..1645903 (+)	300	WP_000234804.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACEPXO_RS08325 (ACEPXO_08325)	comGF	1645857..1646318 (+)	462	WP_001874812.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACEPXO_RS08330 (ACEPXO_08330)	comGG	1646296..1646667 (+)	372	WP_000601104.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACEPXO_RS08335 (ACEPXO_08335)	comGH	1646782..1647756 (+)	975	WP_001008574.1	class I SAM-dependent methyltransferase	Machinery gene
ACEPXO_RS08340 (ACEPXO_08340)	-	1647788..1648981 (+)	1194	WP_000047534.1	acetate kinase	-
ACEPXO_RS08345 (ACEPXO_08345)	-	1649133..1649339 (+)	207	WP_000798241.1	helix-turn-helix transcriptional regulator	-
ACEPXO_RS08350 (ACEPXO_08350)	-	1649398..1649535 (+)	138	WP_001865900.1	hypothetical protein	-
ACEPXO_RS08355 (ACEPXO_08355)	-	1649576..1650031 (+)	456	WP_000905673.1	hypothetical protein	-
ACEPXO_RS08360 (ACEPXO_08360)	-	1650100..1650765 (+)	666	WP_000008113.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

• Length: 153 a.a.
• Molecular weight: 17875.89 Da
• Isoelectric Point: 9.8392

>NTDB_id=935674 ACEPXO_RS08325 WP_001874812.1 1645857..1646318(+) (comGF) [Streptococcus agalactiae strain SA2BKE]
MKIIRKFCTYQKLRVKAFTLLECLVALVTITGALLVYQGLTKLLAQQIVVMSSSSQSEWVLLTQQLNAEFEGAHLEYLRQ
NKLYLRKQDKIVTFGKSNKDDFRKTGYDGRGYQPMVYGLDNCQMSQTKSMVKLVFYFKDGLKRTFYYDFKEET

Nucleotide

• Length: 462 bp

>NTDB_id=935674 ACEPXO_RS08325 WP_001874812.1 1645857..1646318(+) (comGF) [Streptococcus agalactiae strain SA2BKE]
TTGAAGATAATAAGGAAATTTTGCACGTATCAAAAGTTAAGGGTTAAAGCATTTACGCTTTTAGAATGTTTGGTAGCATT
GGTTACAATCACAGGAGCTTTACTAGTTTATCAAGGACTGACAAAATTGTTGGCTCAACAGATAGTAGTGATGTCTTCTT
CCAGTCAGTCTGAATGGGTGTTATTAACTCAGCAACTAAATGCAGAATTTGAAGGCGCTCATCTGGAATATTTAAGACAG
AACAAACTTTATTTACGTAAGCAAGATAAGATTGTAACCTTTGGCAAATCTAATAAAGATGATTTCCGTAAGACAGGTTA
TGATGGTCGAGGTTATCAACCAATGGTTTATGGGTTAGACAATTGTCAAATGAGTCAGACCAAAAGTATGGTAAAACTTG
TTTTTTATTTTAAGGACGGGTTAAAAAGGACATTTTACTATGATTTTAAAGAAGAAACTTAA

Domains

Predicted by InterProScan.

• Putative Competence protein ComGF (ComGF) (49-142)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF	Streptococcus mutans UA159	47.887	92.81	0.444
comGF	Streptococcus mutans UA140	47.887	92.81	0.444
comGF/cglF	Streptococcus pneumoniae Rx1	43.165	90.85	0.392
comGF/cglF	Streptococcus pneumoniae D39	43.165	90.85	0.392
comGF/cglF	Streptococcus pneumoniae R6	43.165	90.85	0.392
comGF/cglF	Streptococcus pneumoniae TIGR4	43.165	90.85	0.392
comGF/cglF	Streptococcus mitis SK321	44.03	87.582	0.386
comGF/cglF	Streptococcus mitis NCTC 12261	43.284	87.582	0.379
comGF	Lactococcus lactis subsp. cremoris KW2	40.714	91.503	0.373