Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   V5F83_RS12435 Genome accession   NZ_CP144764
Coordinates   2503933..2504460 (-) Length   175 a.a.
NCBI ID   WP_142426472.1    Uniprot ID   -
Organism   Enterococcus faecalis strain HRH46     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2467389..2513384 2503933..2504460 within 0


Gene organization within MGE regions


Location: 2467389..2513384
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V5F83_RS12175 (V5F83_12175) - 2467389..2467931 (-) 543 WP_002362346.1 5-formyltetrahydrofolate cyclo-ligase -
  V5F83_RS12180 (V5F83_12180) - 2468019..2468789 (-) 771 WP_002356329.1 alpha/beta fold hydrolase -
  V5F83_RS12185 (V5F83_12185) - 2468955..2469530 (+) 576 WP_002378653.1 DUF805 domain-containing protein -
  V5F83_RS12190 (V5F83_12190) - 2469621..2471186 (+) 1566 WP_002401669.1 membrane protein -
  V5F83_RS12195 (V5F83_12195) - 2471138..2472271 (+) 1134 WP_002401668.1 DUF4950 domain-containing protein -
  V5F83_RS12200 (V5F83_12200) - 2472531..2473595 (-) 1065 WP_002378657.1 FUSC family protein -
  V5F83_RS12205 (V5F83_12205) - 2473851..2474102 (-) 252 WP_002401667.1 hypothetical protein -
  V5F83_RS12215 (V5F83_12215) - 2474610..2475095 (-) 486 WP_338459176.1 hypothetical protein -
  V5F83_RS12220 (V5F83_12220) - 2475367..2476182 (-) 816 WP_174081532.1 DUF3825 domain-containing protein -
  V5F83_RS12225 (V5F83_12225) - 2476551..2477852 (-) 1302 WP_338459177.1 LysM peptidoglycan-binding domain-containing protein -
  V5F83_RS12230 (V5F83_12230) - 2477855..2478061 (-) 207 WP_002380792.1 phage holin -
  V5F83_RS12235 (V5F83_12235) - 2478058..2478279 (-) 222 WP_002397443.1 hypothetical protein -
  V5F83_RS12240 (V5F83_12240) - 2478307..2478462 (-) 156 WP_002411012.1 XkdX family protein -
  V5F83_RS12245 (V5F83_12245) - 2478464..2478784 (-) 321 WP_104888303.1 hypothetical protein -
  V5F83_RS12250 (V5F83_12250) - 2478796..2479260 (-) 465 WP_010731634.1 hypothetical protein -
  V5F83_RS12255 (V5F83_12255) - 2479260..2479577 (-) 318 WP_142666528.1 hypothetical protein -
  V5F83_RS12260 (V5F83_12260) - 2479570..2479887 (-) 318 WP_073437706.1 hypothetical protein -
  V5F83_RS12265 (V5F83_12265) - 2479884..2480756 (-) 873 WP_010708914.1 phage baseplate upper protein -
  V5F83_RS12270 (V5F83_12270) - 2480771..2483485 (-) 2715 WP_185946620.1 phage tail spike protein -
  V5F83_RS12275 (V5F83_12275) - 2483467..2484201 (-) 735 WP_115253422.1 phage tail protein -
  V5F83_RS12280 (V5F83_12280) - 2484191..2487088 (-) 2898 WP_338459456.1 tape measure protein -
  V5F83_RS12285 (V5F83_12285) - 2487335..2487688 (-) 354 WP_002364485.1 hypothetical protein -
  V5F83_RS12290 (V5F83_12290) - 2487741..2488583 (-) 843 WP_010784636.1 major tail protein -
  V5F83_RS12295 (V5F83_12295) - 2488584..2488958 (-) 375 WP_010784637.1 DUF6838 family protein -
  V5F83_RS12300 (V5F83_12300) - 2488962..2489360 (-) 399 WP_002402415.1 HK97 gp10 family phage protein -
  V5F83_RS12305 (V5F83_12305) - 2489353..2489730 (-) 378 WP_025193068.1 hypothetical protein -
  V5F83_RS12310 (V5F83_12310) - 2489727..2490071 (-) 345 WP_010784639.1 hypothetical protein -
  V5F83_RS12315 (V5F83_12315) - 2490080..2490316 (-) 237 WP_002372022.1 hypothetical protein -
  V5F83_RS12320 (V5F83_12320) - 2490340..2491242 (-) 903 WP_010784640.1 DUF5309 family protein -
  V5F83_RS12325 (V5F83_12325) - 2491256..2491882 (-) 627 WP_338459181.1 DUF4355 domain-containing protein -
  V5F83_RS12330 (V5F83_12330) - 2492039..2492209 (-) 171 WP_010822878.1 hypothetical protein -
  V5F83_RS12335 (V5F83_12335) - 2492213..2492515 (-) 303 WP_338459182.1 glutaredoxin domain-containing protein -
  V5F83_RS12340 (V5F83_12340) - 2492520..2492840 (-) 321 WP_010784641.1 hypothetical protein -
  V5F83_RS12345 (V5F83_12345) - 2492897..2493127 (-) 231 WP_002414519.1 hypothetical protein -
  V5F83_RS12350 (V5F83_12350) - 2493128..2494912 (-) 1785 WP_010784642.1 phage minor head protein -
  V5F83_RS12355 (V5F83_12355) - 2494887..2496362 (-) 1476 WP_010784643.1 phage portal protein -
  V5F83_RS12360 (V5F83_12360) - 2496375..2497649 (-) 1275 WP_338459458.1 PBSX family phage terminase large subunit -
  V5F83_RS12365 (V5F83_12365) - 2497639..2498100 (-) 462 WP_002414515.1 terminase small subunit -
  V5F83_RS12370 (V5F83_12370) - 2498154..2498372 (-) 219 WP_029656257.1 hypothetical protein -
  V5F83_RS12375 (V5F83_12375) - 2498466..2499089 (-) 624 WP_010823188.1 hypothetical protein -
  V5F83_RS12380 (V5F83_12380) - 2499337..2499756 (-) 420 WP_338459185.1 transcriptional regulator -
  V5F83_RS12385 (V5F83_12385) - 2499757..2499996 (-) 240 WP_142428999.1 hypothetical protein -
  V5F83_RS12390 (V5F83_12390) - 2499993..2500199 (-) 207 WP_142428998.1 hypothetical protein -
  V5F83_RS12395 (V5F83_12395) - 2500382..2500900 (-) 519 WP_010708933.1 DUF1642 domain-containing protein -
  V5F83_RS12400 (V5F83_12400) - 2500912..2501160 (-) 249 WP_002406053.1 hypothetical protein -
  V5F83_RS12405 (V5F83_12405) - 2501157..2501492 (-) 336 WP_338459186.1 hypothetical protein -
  V5F83_RS12410 (V5F83_12410) - 2501493..2501873 (-) 381 WP_010784646.1 YopX family protein -
  V5F83_RS12415 (V5F83_12415) - 2501870..2502106 (-) 237 WP_025193072.1 hypothetical protein -
  V5F83_RS12420 (V5F83_12420) dcm 2502114..2503310 (-) 1197 WP_338459187.1 DNA (cytosine-5-)-methyltransferase -
  V5F83_RS12425 (V5F83_12425) - 2503366..2503572 (-) 207 WP_002365163.1 hypothetical protein -
  V5F83_RS12430 (V5F83_12430) - 2503592..2503921 (-) 330 WP_002402237.1 hypothetical protein -
  V5F83_RS12435 (V5F83_12435) ssb 2503933..2504460 (-) 528 WP_142426472.1 single-stranded DNA-binding protein Machinery gene
  V5F83_RS12440 (V5F83_12440) - 2504465..2505307 (-) 843 WP_142426487.1 DNA replication protein -
  V5F83_RS12445 (V5F83_12445) - 2505327..2505812 (-) 486 WP_113847620.1 hypothetical protein -
  V5F83_RS12450 (V5F83_12450) - 2505818..2506459 (-) 642 WP_338459190.1 putative HNHc nuclease -
  V5F83_RS12455 (V5F83_12455) - 2506460..2507152 (-) 693 WP_338459191.1 DUF1071 domain-containing protein -
  V5F83_RS12460 (V5F83_12460) - 2507145..2507468 (-) 324 WP_033600921.1 hypothetical protein -
  V5F83_RS12465 (V5F83_12465) - 2507668..2507841 (-) 174 WP_002395693.1 hypothetical protein -
  V5F83_RS12470 (V5F83_12470) - 2507853..2508038 (-) 186 WP_002364665.1 hypothetical protein -
  V5F83_RS12475 (V5F83_12475) - 2508049..2508759 (-) 711 WP_338459192.1 Rha family transcriptional regulator -
  V5F83_RS12480 (V5F83_12480) - 2509173..2509370 (-) 198 WP_010708945.1 hypothetical protein -
  V5F83_RS12485 (V5F83_12485) - 2509405..2509674 (-) 270 WP_002414623.1 hypothetical protein -
  V5F83_RS12490 (V5F83_12490) - 2509689..2509883 (-) 195 WP_010708946.1 helix-turn-helix transcriptional regulator -
  V5F83_RS12495 (V5F83_12495) - 2510128..2510475 (+) 348 WP_002401993.1 helix-turn-helix transcriptional regulator -
  V5F83_RS12500 (V5F83_12500) - 2510504..2510914 (+) 411 WP_002401992.1 ImmA/IrrE family metallo-endopeptidase -
  V5F83_RS12505 (V5F83_12505) - 2511004..2511738 (+) 735 WP_010708947.1 DUF4950 domain-containing protein -
  V5F83_RS12510 (V5F83_12510) - 2511751..2512080 (+) 330 WP_010708948.1 hypothetical protein -
  V5F83_RS12515 (V5F83_12515) - 2512203..2513384 (+) 1182 WP_010708949.1 site-specific integrase -

Sequence

Protein


Download         Length: 175 a.a.        Molecular weight: 19283.18 Da        Isoelectric Point: 4.7078

>NTDB_id=934852 V5F83_RS12435 WP_142426472.1 2503933..2504460(-) (ssb) [Enterococcus faecalis strain HRH46]
MINQVVLVGRLTKDIDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLEAKSANENRNSIQSSQNSVTGVQNNFESNYAANQNKGLNQQNNSQQMSFGGDVDPFA
GAGNSIDISDDDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=934852 V5F83_RS12435 WP_142426472.1 2503933..2504460(-) (ssb) [Enterococcus faecalis strain HRH46]
ATGATAAACCAAGTTGTGTTAGTTGGACGTTTAACGAAAGATATAGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAACTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGTAAAGGAACATTATTAGGAGTTGTTGGCAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAGAGTTTCCAATTATTAGAGGCAAAAAG
CGCCAATGAGAATAGAAATAGCATTCAGAGTTCACAGAATAGCGTTACAGGCGTTCAAAATAATTTCGAGAGTAATTATG
CTGCGAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCCAACAAATGTCGTTTGGTGGAGATGTAGATCCGTTCGCA
GGTGCAGGTAATTCAATCGACATTAGCGATGATGATCTGCCTTTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

58.989

100

0.6
  ssbA Bacillus subtilis subsp. subtilis str. 168

58.427

100

0.594
  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

60.571

0.36