Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   V4S36_RS00165 Genome accession   NZ_CP144490
Coordinates   31057..31575 (+) Length   172 a.a.
NCBI ID   WP_016250467.1    Uniprot ID   A0A0H2QMK6
Organism   Enterococcus cecorum strain 127     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2671..64501 31057..31575 within 0


Gene organization within MGE regions


Location: 2671..64501
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V4S36_RS00015 (V4S36_00015) - 3061..4272 (+) 1212 WP_347943842.1 MFS transporter -
  V4S36_RS00020 (V4S36_00020) - 4411..4746 (+) 336 WP_347943843.1 AbrB family transcriptional regulator -
  V4S36_RS00025 (V4S36_00025) yaaA 5000..5248 (+) 249 WP_047334537.1 S4 domain-containing protein YaaA -
  V4S36_RS00030 (V4S36_00030) recF 5235..6374 (+) 1140 WP_347943844.1 DNA replication/repair protein RecF -
  V4S36_RS00035 (V4S36_00035) gyrB 6401..8350 (+) 1950 WP_047334535.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  V4S36_RS00040 (V4S36_00040) gyrA 8370..10874 (+) 2505 WP_347943845.1 DNA gyrase subunit A -
  V4S36_RS00045 (V4S36_00045) - 11087..11458 (+) 372 WP_347943846.1 MmcQ/YjbR family DNA-binding protein -
  V4S36_RS00050 (V4S36_00050) - 11455..12528 (+) 1074 WP_347943847.1 endonuclease/exonuclease/phosphatase family protein -
  V4S36_RS00055 (V4S36_00055) - 12937..13251 (+) 315 WP_000420682.1 YdcP family protein -
  V4S36_RS00060 (V4S36_00060) - 13267..13653 (+) 387 WP_000985015.1 YdcP family protein -
  V4S36_RS00065 (V4S36_00065) - 13682..15067 (+) 1386 WP_347943848.1 FtsK/SpoIIIE domain-containing protein -
  V4S36_RS00070 (V4S36_00070) - 15070..15221 (+) 152 Protein_13 conjugal transfer protein -
  V4S36_RS00075 (V4S36_00075) mobT 15244..16449 (+) 1206 WP_347943849.1 MobT family relaxase -
  V4S36_RS00080 (V4S36_00080) - 16492..16713 (+) 222 WP_001009056.1 hypothetical protein -
  V4S36_RS00085 (V4S36_00085) - 16830..17327 (+) 498 WP_000342539.1 antirestriction protein ArdA -
  V4S36_RS00090 (V4S36_00090) - 17416..17808 (+) 393 WP_000723888.1 conjugal transfer protein -
  V4S36_RS00095 (V4S36_00095) - 17792..20239 (+) 2448 WP_006701291.1 ATP-binding protein -
  V4S36_RS00100 (V4S36_00100) - 20242..22419 (+) 2178 WP_000804748.1 membrane protein -
  V4S36_RS00105 (V4S36_00105) - 22416..23297 (+) 882 WP_174854705.1 bifunctional lysozyme/C40 family peptidase -
  V4S36_RS00110 (V4S36_00110) - 23294..24229 (+) 936 WP_001224320.1 conjugal transfer protein -
  V4S36_RS00115 (V4S36_00115) - 24474..24590 (+) 117 WP_001791010.1 tetracycline resistance determinant leader peptide -
  V4S36_RS00120 (V4S36_00120) tet(M) 24606..26525 (+) 1920 WP_047339182.1 tetracycline resistance ribosomal protection protein Tet(M) -
  V4S36_RS00125 (V4S36_00125) - 26644..26808 (+) 165 Protein_24 cysteine-rich KTR domain-containing protein -
  V4S36_RS00130 (V4S36_00130) - 26878..27231 (-) 354 WP_347943850.1 helix-turn-helix domain-containing protein -
  V4S36_RS00135 (V4S36_00135) - 27736..28158 (+) 423 WP_000804885.1 sigma-70 family RNA polymerase sigma factor -
  V4S36_RS00140 (V4S36_00140) - 28155..28385 (+) 231 WP_000857133.1 helix-turn-helix domain-containing protein -
  V4S36_RS00145 (V4S36_00145) - 28611..28862 (-) 252 WP_001845478.1 hypothetical protein -
  V4S36_RS00150 (V4S36_00150) - 28846..29049 (+) 204 WP_000814511.1 excisionase -
  V4S36_RS00155 (V4S36_00155) - 29131..30348 (+) 1218 WP_001291561.1 tyrosine-type recombinase/integrase -
  V4S36_RS00160 (V4S36_00160) rpsF 30715..31014 (+) 300 WP_016250468.1 30S ribosomal protein S6 -
  V4S36_RS00165 (V4S36_00165) ssb 31057..31575 (+) 519 WP_016250467.1 single-stranded DNA-binding protein Machinery gene
  V4S36_RS00170 (V4S36_00170) rpsR 31605..31841 (+) 237 WP_016250466.1 30S ribosomal protein S18 -
  V4S36_RS00175 (V4S36_00175) - 32029..32457 (+) 429 WP_347943851.1 NUDIX hydrolase -
  V4S36_RS00180 (V4S36_00180) - 32842..34293 (+) 1452 WP_347943853.1 DHH family phosphoesterase -
  V4S36_RS00185 (V4S36_00185) rplI 34306..34758 (+) 453 WP_016250461.1 50S ribosomal protein L9 -
  V4S36_RS00190 (V4S36_00190) - 34830..35297 (+) 468 WP_347943854.1 NUDIX domain-containing protein -
  V4S36_RS00195 (V4S36_00195) dnaB 35453..36823 (+) 1371 WP_347943855.1 replicative DNA helicase -
  V4S36_RS00200 (V4S36_00200) - 37391..39553 (+) 2163 WP_347943856.1 PTS transporter subunit IIBC -
  V4S36_RS00205 (V4S36_00205) - 39653..40450 (+) 798 WP_087402480.1 endonuclease/exonuclease/phosphatase family protein -
  V4S36_RS00210 (V4S36_00210) - 40710..42002 (+) 1293 WP_047241769.1 adenylosuccinate synthase -
  V4S36_RS00215 (V4S36_00215) - 42425..43270 (+) 846 WP_171333238.1 Rpn family recombination-promoting nuclease/putative transposase -
  V4S36_RS00220 (V4S36_00220) - 43542..44744 (-) 1203 WP_204644630.1 MFS transporter -
  V4S36_RS00225 (V4S36_00225) - 45056..46687 (-) 1632 WP_016250453.1 ATP-binding cassette domain-containing protein -
  V4S36_RS00230 (V4S36_00230) - 47134..47466 (+) 333 WP_016250439.1 PTS sugar transporter subunit IIB -
  V4S36_RS00235 (V4S36_00235) - 47486..47848 (+) 363 WP_016250438.1 PTS lactose/cellobiose transporter subunit IIA -
  V4S36_RS00240 (V4S36_00240) - 47907..48995 (+) 1089 WP_347943857.1 MupG family TIM beta-alpha barrel fold protein -
  V4S36_RS00245 (V4S36_00245) - 49265..50701 (+) 1437 WP_087403300.1 6-phospho-beta-glucosidase -
  V4S36_RS00250 (V4S36_00250) - 50766..51260 (+) 495 WP_047241747.1 hypothetical protein -
  V4S36_RS00255 (V4S36_00255) celB 51283..52629 (+) 1347 WP_347907841.1 PTS cellobiose transporter subunit IIC -
  V4S36_RS00260 (V4S36_00260) - 52729..53442 (-) 714 WP_087663275.1 GntR family transcriptional regulator -
  V4S36_RS00265 (V4S36_00265) - 53623..55104 (+) 1482 WP_168931964.1 family 1 glycosylhydrolase -
  V4S36_RS00270 (V4S36_00270) - 55151..56398 (-) 1248 WP_243188467.1 glutamate-5-semialdehyde dehydrogenase -
  V4S36_RS00275 (V4S36_00275) proB 56414..57217 (-) 804 WP_243190910.1 glutamate 5-kinase -
  V4S36_RS00280 (V4S36_00280) - 57351..57866 (-) 516 WP_347906318.1 Fic family protein -
  V4S36_RS00285 (V4S36_00285) - 57823..58047 (-) 225 WP_347906319.1 hypothetical protein -
  V4S36_RS00290 (V4S36_00290) - 58270..58791 (+) 522 WP_087213972.1 dUTP pyrophosphatase -
  V4S36_RS00295 (V4S36_00295) radA 58804..60174 (+) 1371 WP_047333966.1 DNA repair protein RadA Machinery gene
  V4S36_RS00300 (V4S36_00300) - 60509..61615 (+) 1107 WP_047338892.1 PIN/TRAM domain-containing protein -
  V4S36_RS00305 (V4S36_00305) - 61832..62137 (+) 306 WP_087663274.1 hypothetical protein -
  V4S36_RS00310 (V4S36_00310) - 62193..62681 (+) 489 WP_347943858.1 GNAT family N-acetyltransferase -
  V4S36_RS00315 (V4S36_00315) gltX 62776..64233 (+) 1458 WP_047338895.1 glutamate--tRNA ligase -

Sequence


Protein


Download         Length: 172 a.a.        Molecular weight: 19042.89 Da        Isoelectric Point: 4.7093

>NTDB_id=934009 V4S36_RS00165 WP_016250467.1 31057..31575(+) (ssb) [Enterococcus cecorum strain 127]
MINNVVLVGRLTRDPDLRYTSSGVAVATFSLAVNRNFTSQNGERETDFINCVIWRKPAETLANYARKGTLIGLTGRIQTR
NYENQQGQRVYVTEVVADNFQLLESKAVNDQRRQAAGNFDNNVSQPFNNNNNSFDQPASSQPFSGMPGFDRDASNTPLGG
SSIDISDDDLPF

Nucleotide


Download         Length: 519 bp        

>NTDB_id=934009 V4S36_RS00165 WP_016250467.1 31057..31575(+) (ssb) [Enterococcus cecorum strain 127]
TTGATTAATAATGTTGTATTAGTAGGTAGATTAACAAGAGACCCTGATTTACGTTACACTTCTTCTGGTGTTGCGGTGGC
TACTTTTAGTTTAGCTGTGAACCGTAATTTTACCAGCCAAAACGGAGAAAGAGAAACGGACTTTATCAATTGTGTCATTT
GGCGTAAACCAGCTGAAACTTTAGCAAATTACGCTAGAAAAGGGACATTAATTGGTTTGACTGGACGTATTCAAACGAGA
AATTATGAAAACCAACAAGGTCAACGTGTGTACGTAACTGAAGTGGTTGCCGATAATTTCCAATTATTAGAGTCTAAAGC
AGTCAATGATCAACGTCGTCAAGCTGCCGGAAACTTTGATAATAATGTCTCACAACCATTTAACAATAATAACAATAGCT
TTGATCAGCCAGCTTCATCTCAACCATTTAGTGGAATGCCTGGCTTTGACCGTGATGCAAGTAACACACCACTTGGCGGA
TCAAGCATTGACATTTCAGATGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0H2QMK6

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

60.345

100

0.61

  ssbA Bacillus subtilis subsp. subtilis str. 168

53.409

100

0.547

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

61.628

0.366