Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   V3H91_RS13240 Genome accession   NZ_CP144281
Coordinates   2639188..2639565 (-) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain SEC-024A     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2634188..2644565
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V3H91_RS13200 - 2634687..2635481 (+) 795 WP_014305407.1 YqhG family protein -
  V3H91_RS13205 sinI 2635658..2635831 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  V3H91_RS13210 sinR 2635865..2636200 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  V3H91_RS13215 tasA 2636248..2637033 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  V3H91_RS13220 sipW 2637097..2637681 (-) 585 WP_025852917.1 signal peptidase I SipW -
  V3H91_RS13225 tapA 2637653..2638324 (-) 672 WP_014305409.1 amyloid fiber anchoring/assembly protein TapA -
  V3H91_RS13230 - 2638583..2638912 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  V3H91_RS13235 - 2638952..2639131 (-) 180 WP_003153093.1 YqzE family protein -
  V3H91_RS13240 comGG 2639188..2639565 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  V3H91_RS13245 comGF 2639566..2640066 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  V3H91_RS13250 comGE 2639975..2640289 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  V3H91_RS13255 comGD 2640273..2640710 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  V3H91_RS13260 comGC 2640700..2641008 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  V3H91_RS13265 comGB 2641013..2642050 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  V3H91_RS13270 comGA 2642037..2643107 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  V3H91_RS13275 - 2643299..2644249 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=933367 V3H91_RS13240 WP_014305410.1 2639188..2639565(-) (comGG) [Bacillus velezensis strain SEC-024A]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=933367 V3H91_RS13240 WP_014305410.1 2639188..2639565(-) (comGG) [Bacillus velezensis strain SEC-024A]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512