Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   V3H91_RS13250 Genome accession   NZ_CP144281
Coordinates   2639975..2640289 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain SEC-024A     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2634975..2645289
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  V3H91_RS13205 sinI 2635658..2635831 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  V3H91_RS13210 sinR 2635865..2636200 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  V3H91_RS13215 tasA 2636248..2637033 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  V3H91_RS13220 sipW 2637097..2637681 (-) 585 WP_025852917.1 signal peptidase I SipW -
  V3H91_RS13225 tapA 2637653..2638324 (-) 672 WP_014305409.1 amyloid fiber anchoring/assembly protein TapA -
  V3H91_RS13230 - 2638583..2638912 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  V3H91_RS13235 - 2638952..2639131 (-) 180 WP_003153093.1 YqzE family protein -
  V3H91_RS13240 comGG 2639188..2639565 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  V3H91_RS13245 comGF 2639566..2640066 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  V3H91_RS13250 comGE 2639975..2640289 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  V3H91_RS13255 comGD 2640273..2640710 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  V3H91_RS13260 comGC 2640700..2641008 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  V3H91_RS13265 comGB 2641013..2642050 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  V3H91_RS13270 comGA 2642037..2643107 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  V3H91_RS13275 - 2643299..2644249 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=933368 V3H91_RS13250 WP_015388003.1 2639975..2640289(-) (comGE) [Bacillus velezensis strain SEC-024A]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=933368 V3H91_RS13250 WP_015388003.1 2639975..2640289(-) (comGE) [Bacillus velezensis strain SEC-024A]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481