Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | V3H91_RS13205 | Genome accession | NZ_CP144281 |
| Coordinates | 2635658..2635831 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain SEC-024A | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2630658..2640831
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| V3H91_RS13190 | gcvT | 2631476..2632576 (-) | 1101 | WP_003153108.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| V3H91_RS13195 | - | 2632999..2634669 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| V3H91_RS13200 | - | 2634687..2635481 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| V3H91_RS13205 | sinI | 2635658..2635831 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| V3H91_RS13210 | sinR | 2635865..2636200 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| V3H91_RS13215 | tasA | 2636248..2637033 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| V3H91_RS13220 | sipW | 2637097..2637681 (-) | 585 | WP_025852917.1 | signal peptidase I SipW | - |
| V3H91_RS13225 | tapA | 2637653..2638324 (-) | 672 | WP_014305409.1 | amyloid fiber anchoring/assembly protein TapA | - |
| V3H91_RS13230 | - | 2638583..2638912 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| V3H91_RS13235 | - | 2638952..2639131 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| V3H91_RS13240 | comGG | 2639188..2639565 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| V3H91_RS13245 | comGF | 2639566..2640066 (-) | 501 | WP_226565836.1 | competence type IV pilus minor pilin ComGF | - |
| V3H91_RS13250 | comGE | 2639975..2640289 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| V3H91_RS13255 | comGD | 2640273..2640710 (-) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=933365 V3H91_RS13205 WP_003153105.1 2635658..2635831(+) (sinI) [Bacillus velezensis strain SEC-024A]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=933365 V3H91_RS13205 WP_003153105.1 2635658..2635831(+) (sinI) [Bacillus velezensis strain SEC-024A]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |