Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   VXF94_RS08945 Genome accession   NZ_CP143956
Coordinates   1754480..1754599 (-) Length   39 a.a.
NCBI ID   WP_013351005.1    Uniprot ID   A0AAP7N4M9
Organism   Bacillus amyloliquefaciens strain Fad 108     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 1749480..1759599
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VXF94_RS08920 (VXF94_08920) - 1749716..1750474 (-) 759 WP_013351009.1 ABC transporter ATP-binding protein -
  VXF94_RS08925 (VXF94_08925) - 1750468..1751415 (-) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  VXF94_RS08930 (VXF94_08930) ceuB 1751405..1752358 (-) 954 WP_013351008.1 ABC transporter permease Machinery gene
  VXF94_RS08935 (VXF94_08935) - 1752772..1754136 (+) 1365 WP_014471434.1 aspartate kinase -
  VXF94_RS08940 (VXF94_08940) - 1754231..1754332 (+) 102 WP_013351006.1 YjcZ family sporulation protein -
  VXF94_RS08945 (VXF94_08945) phrC 1754480..1754599 (-) 120 WP_013351005.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  VXF94_RS08950 (VXF94_08950) rapC 1754583..1755731 (-) 1149 WP_013351004.1 tetratricopeptide repeat protein Regulator
  VXF94_RS08955 (VXF94_08955) - 1755890..1757317 (-) 1428 WP_161988189.1 sensor histidine kinase -
  VXF94_RS08960 (VXF94_08960) - 1757304..1757987 (-) 684 WP_013351002.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=932201 VXF94_RS08945 WP_013351005.1 1754480..1754599(-) (phrC) [Bacillus amyloliquefaciens strain Fad 108]
MKLKSKWFVICLAAAAIFTAAGVSQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=932201 VXF94_RS08945 WP_013351005.1 1754480..1754599(-) (phrC) [Bacillus amyloliquefaciens strain Fad 108]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGCTGCAGGTGTAAGCCAGACAGA
TCAGGCTGAATTCCATGTGGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

80

100

0.821