Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   U6C02_RS12720 Genome accession   NZ_CP143843
Coordinates   2444074..2444511 (+) Length   145 a.a.
NCBI ID   WP_072588444.1    Uniprot ID   -
Organism   Bacillus velezensis strain YM-3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2439074..2449511
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U6C02_RS12695 (U6C02_12695) - 2439088..2440389 (-) 1302 WP_014305416.1 hemolysin family protein -
  U6C02_RS12700 (U6C02_12700) - 2440535..2441485 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  U6C02_RS12705 (U6C02_12705) comGA 2441677..2442747 (+) 1071 WP_057080484.1 competence type IV pilus ATPase ComGA Machinery gene
  U6C02_RS12710 (U6C02_12710) comGB 2442734..2443771 (+) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  U6C02_RS12715 (U6C02_12715) comGC 2443776..2444084 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  U6C02_RS12720 (U6C02_12720) comGD 2444074..2444511 (+) 438 WP_072588444.1 competence type IV pilus minor pilin ComGD Machinery gene
  U6C02_RS12725 (U6C02_12725) comGE 2444495..2444809 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  U6C02_RS12730 (U6C02_12730) comGF 2444718..2445218 (+) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  U6C02_RS12735 (U6C02_12735) comGG 2445219..2445596 (+) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  U6C02_RS12740 (U6C02_12740) - 2445653..2445832 (+) 180 WP_003153093.1 YqzE family protein -
  U6C02_RS12745 (U6C02_12745) - 2445872..2446201 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  U6C02_RS12750 (U6C02_12750) tapA 2446460..2447131 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  U6C02_RS12755 (U6C02_12755) sipW 2447103..2447687 (+) 585 WP_003153100.1 signal peptidase I SipW -
  U6C02_RS12760 (U6C02_12760) tasA 2447751..2448536 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  U6C02_RS12765 (U6C02_12765) sinR 2448584..2448919 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  U6C02_RS12770 (U6C02_12770) sinI 2448953..2449126 (-) 174 WP_003153105.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16312.84 Da        Isoelectric Point: 10.3354

>NTDB_id=931525 U6C02_RS12720 WP_072588444.1 2444074..2444511(+) (comGD) [Bacillus velezensis strain YM-3]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSSGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=931525 U6C02_RS12720 WP_072588444.1 2444074..2444511(+) (comGD) [Bacillus velezensis strain YM-3]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACTCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAAGCGGTAGGATTGTCGAGCGTTCTTTTGATTCACTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559