Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   U6C02_RS12770 Genome accession   NZ_CP143843
Coordinates   2448953..2449126 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain YM-3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2443953..2454126
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U6C02_RS12720 (U6C02_12720) comGD 2444074..2444511 (+) 438 WP_072588444.1 competence type IV pilus minor pilin ComGD Machinery gene
  U6C02_RS12725 (U6C02_12725) comGE 2444495..2444809 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  U6C02_RS12730 (U6C02_12730) comGF 2444718..2445218 (+) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  U6C02_RS12735 (U6C02_12735) comGG 2445219..2445596 (+) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  U6C02_RS12740 (U6C02_12740) - 2445653..2445832 (+) 180 WP_003153093.1 YqzE family protein -
  U6C02_RS12745 (U6C02_12745) - 2445872..2446201 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  U6C02_RS12750 (U6C02_12750) tapA 2446460..2447131 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  U6C02_RS12755 (U6C02_12755) sipW 2447103..2447687 (+) 585 WP_003153100.1 signal peptidase I SipW -
  U6C02_RS12760 (U6C02_12760) tasA 2447751..2448536 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  U6C02_RS12765 (U6C02_12765) sinR 2448584..2448919 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  U6C02_RS12770 (U6C02_12770) sinI 2448953..2449126 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  U6C02_RS12775 (U6C02_12775) - 2449303..2450097 (-) 795 WP_014305407.1 YqhG family protein -
  U6C02_RS12780 (U6C02_12780) - 2450115..2451785 (-) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  U6C02_RS12785 (U6C02_12785) gcvT 2452208..2453308 (+) 1101 WP_058906182.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=931529 U6C02_RS12770 WP_003153105.1 2448953..2449126(-) (sinI) [Bacillus velezensis strain YM-3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=931529 U6C02_RS12770 WP_003153105.1 2448953..2449126(-) (sinI) [Bacillus velezensis strain YM-3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702