Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | VT264_RS11960 | Genome accession | NZ_CP143266 |
| Coordinates | 2502868..2503041 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain JBCS608 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2497868..2508041
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| VT264_RS11945 (VT264_11945) | gcvT | 2498683..2499783 (-) | 1101 | WP_024085597.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| VT264_RS11950 (VT264_11950) | - | 2500209..2501879 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| VT264_RS11955 (VT264_11955) | - | 2501897..2502691 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| VT264_RS11960 (VT264_11960) | sinI | 2502868..2503041 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| VT264_RS11965 (VT264_11965) | sinR | 2503075..2503410 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| VT264_RS11970 (VT264_11970) | tasA | 2503458..2504243 (-) | 786 | WP_015388008.1 | biofilm matrix protein TasA | - |
| VT264_RS11975 (VT264_11975) | sipW | 2504307..2504891 (-) | 585 | WP_003153100.1 | signal peptidase I SipW | - |
| VT264_RS11980 (VT264_11980) | tapA | 2504863..2505534 (-) | 672 | WP_024085598.1 | amyloid fiber anchoring/assembly protein TapA | - |
| VT264_RS11985 (VT264_11985) | - | 2505794..2506123 (+) | 330 | WP_024085599.1 | DUF3889 domain-containing protein | - |
| VT264_RS11990 (VT264_11990) | - | 2506163..2506342 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| VT264_RS11995 (VT264_11995) | comGG | 2506399..2506776 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| VT264_RS12000 (VT264_12000) | comGF | 2506777..2507277 (-) | 501 | WP_223203779.1 | competence type IV pilus minor pilin ComGF | - |
| VT264_RS12005 (VT264_12005) | comGE | 2507186..2507500 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| VT264_RS12010 (VT264_12010) | comGD | 2507484..2507921 (-) | 438 | WP_024085600.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=928415 VT264_RS11960 WP_003153105.1 2502868..2503041(+) (sinI) [Bacillus velezensis strain JBCS608]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=928415 VT264_RS11960 WP_003153105.1 2502868..2503041(+) (sinI) [Bacillus velezensis strain JBCS608]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |