Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   VT264_RS11960 Genome accession   NZ_CP143266
Coordinates   2502868..2503041 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain JBCS608     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2497868..2508041
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VT264_RS11945 (VT264_11945) gcvT 2498683..2499783 (-) 1101 WP_024085597.1 glycine cleavage system aminomethyltransferase GcvT -
  VT264_RS11950 (VT264_11950) - 2500209..2501879 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  VT264_RS11955 (VT264_11955) - 2501897..2502691 (+) 795 WP_003153106.1 YqhG family protein -
  VT264_RS11960 (VT264_11960) sinI 2502868..2503041 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  VT264_RS11965 (VT264_11965) sinR 2503075..2503410 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  VT264_RS11970 (VT264_11970) tasA 2503458..2504243 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  VT264_RS11975 (VT264_11975) sipW 2504307..2504891 (-) 585 WP_003153100.1 signal peptidase I SipW -
  VT264_RS11980 (VT264_11980) tapA 2504863..2505534 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  VT264_RS11985 (VT264_11985) - 2505794..2506123 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  VT264_RS11990 (VT264_11990) - 2506163..2506342 (-) 180 WP_003153093.1 YqzE family protein -
  VT264_RS11995 (VT264_11995) comGG 2506399..2506776 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  VT264_RS12000 (VT264_12000) comGF 2506777..2507277 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  VT264_RS12005 (VT264_12005) comGE 2507186..2507500 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  VT264_RS12010 (VT264_12010) comGD 2507484..2507921 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=928415 VT264_RS11960 WP_003153105.1 2502868..2503041(+) (sinI) [Bacillus velezensis strain JBCS608]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=928415 VT264_RS11960 WP_003153105.1 2502868..2503041(+) (sinI) [Bacillus velezensis strain JBCS608]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702