Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   VT264_RS12005 Genome accession   NZ_CP143266
Coordinates   2507186..2507500 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain JBCS608     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2502186..2512500
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VT264_RS11960 (VT264_11960) sinI 2502868..2503041 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  VT264_RS11965 (VT264_11965) sinR 2503075..2503410 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  VT264_RS11970 (VT264_11970) tasA 2503458..2504243 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  VT264_RS11975 (VT264_11975) sipW 2504307..2504891 (-) 585 WP_003153100.1 signal peptidase I SipW -
  VT264_RS11980 (VT264_11980) tapA 2504863..2505534 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  VT264_RS11985 (VT264_11985) - 2505794..2506123 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  VT264_RS11990 (VT264_11990) - 2506163..2506342 (-) 180 WP_003153093.1 YqzE family protein -
  VT264_RS11995 (VT264_11995) comGG 2506399..2506776 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  VT264_RS12000 (VT264_12000) comGF 2506777..2507277 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  VT264_RS12005 (VT264_12005) comGE 2507186..2507500 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  VT264_RS12010 (VT264_12010) comGD 2507484..2507921 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene
  VT264_RS12015 (VT264_12015) comGC 2507911..2508177 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  VT264_RS12020 (VT264_12020) comGB 2508224..2509261 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  VT264_RS12025 (VT264_12025) comGA 2509248..2510318 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  VT264_RS12030 (VT264_12030) - 2510510..2511460 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=928418 VT264_RS12005 WP_015388003.1 2507186..2507500(-) (comGE) [Bacillus velezensis strain JBCS608]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=928418 VT264_RS12005 WP_015388003.1 2507186..2507500(-) (comGE) [Bacillus velezensis strain JBCS608]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481