Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   QUE82_RS12800 Genome accession   NZ_AP028059
Coordinates   2389193..2389567 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. natto strain NARUSE     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2384193..2394567
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QUE82_RS12760 (BSNN_25040) yqhG 2384525..2385319 (+) 795 WP_014480249.1 YqhG family protein -
  QUE82_RS12765 (BSNN_25050) sinI 2385502..2385675 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QUE82_RS12770 (BSNN_25060) sinR 2385709..2386044 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QUE82_RS12775 (BSNN_25070) tasA 2386137..2386922 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  QUE82_RS12780 (BSNN_25080) sipW 2386986..2387558 (-) 573 WP_003230181.1 signal peptidase I SipW -
  QUE82_RS12785 (BSNN_25090) tapA 2387542..2388303 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  QUE82_RS12790 (BSNN_25100) yqzG 2388575..2388901 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QUE82_RS12795 (BSNN_25110) spoIITA 2388943..2389122 (-) 180 WP_014480252.1 YqzE family protein -
  QUE82_RS12800 (BSNN_25120) comGG 2389193..2389567 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  QUE82_RS12805 (BSNN_25130) comGF 2389568..2389951 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  QUE82_RS12810 (BSNN_25140) comGE 2389977..2390324 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  QUE82_RS12815 (BSNN_25150) comGD 2390308..2390739 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  QUE82_RS12820 (BSNN_25160) comGC 2390729..2391025 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  QUE82_RS12825 (BSNN_25170) comGB 2391039..2392076 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  QUE82_RS12830 (BSNN_25180) comGA 2392063..2393133 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  QUE82_RS12835 (BSNN_25200) - 2393345..2393542 (-) 198 WP_014480259.1 CBS domain-containing protein -
  QUE82_RS12840 (BSNN_25210) corA 2393544..2394497 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=92373 QUE82_RS12800 WP_014480253.1 2389193..2389567(-) (comGG) [Bacillus subtilis subsp. natto strain NARUSE]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=92373 QUE82_RS12800 WP_014480253.1 2389193..2389567(-) (comGG) [Bacillus subtilis subsp. natto strain NARUSE]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976


Multiple sequence alignment