Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   VA212_RS00195 Genome accession   NZ_CP141838
Coordinates   37869..37994 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori strain P07928     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 32869..42994
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VA212_RS00170 - 32931..35153 (+) 2223 WP_324660506.1 ATP-dependent Clp protease ATP-binding subunit -
  VA212_RS00175 panD 35143..35493 (+) 351 WP_324660508.1 aspartate 1-decarboxylase -
  VA212_RS00180 - 35504..35797 (+) 294 WP_324660509.1 YbaB/EbfC family nucleoid-associated protein -
  VA212_RS00185 - 35797..36792 (+) 996 WP_324661395.1 PDZ domain-containing protein -
  VA212_RS00190 comB6 36798..37853 (+) 1056 WP_324660511.1 P-type conjugative transfer protein TrbL Machinery gene
  VA212_RS00195 comB7 37869..37994 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  VA212_RS00200 comB8 37991..38734 (+) 744 WP_000660524.1 type IV secretion system protein Machinery gene
  VA212_RS00205 comB9 38734..39708 (+) 975 WP_324660513.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  VA212_RS00210 comB10 39701..40837 (+) 1137 WP_324660516.1 DNA type IV secretion system protein ComB10 Machinery gene
  VA212_RS00215 - 40907..42319 (+) 1413 WP_324660518.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=920087 VA212_RS00195 WP_001217874.1 37869..37994(+) (comB7) [Helicobacter pylori strain P07928]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=920087 VA212_RS00195 WP_001217874.1 37869..37994(+) (comB7) [Helicobacter pylori strain P07928]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTACATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878