Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   VO180_RS17740 Genome accession   NZ_CP141826
Coordinates   3616850..3616969 (-) Length   39 a.a.
NCBI ID   WP_031378677.1    Uniprot ID   -
Organism   Bacillus velezensis strain XHA16     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3611850..3621969
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  VO180_RS17715 (VO180_17715) - 3612091..3612849 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  VO180_RS17720 (VO180_17720) - 3612843..3613790 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  VO180_RS17725 (VO180_17725) ceuB 3613780..3614733 (-) 954 WP_015239156.1 ABC transporter permease Machinery gene
  VO180_RS17730 (VO180_17730) - 3615147..3616511 (+) 1365 WP_199022338.1 aspartate kinase -
  VO180_RS17735 (VO180_17735) - 3616591..3616701 (+) 111 WP_369719092.1 YjcZ family sporulation protein -
  VO180_RS17740 (VO180_17740) phrC 3616850..3616969 (-) 120 WP_031378677.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  VO180_RS17745 (VO180_17745) rapC 3616953..3618101 (-) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  VO180_RS17750 (VO180_17750) - 3618254..3619687 (-) 1434 WP_324636132.1 HAMP domain-containing sensor histidine kinase -
  VO180_RS17755 (VO180_17755) - 3619674..3620357 (-) 684 WP_007410267.1 response regulator transcription factor -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4240.97 Da        Isoelectric Point: 8.0284

>NTDB_id=919848 VO180_RS17740 WP_031378677.1 3616850..3616969(-) (phrC) [Bacillus velezensis strain XHA16]
MKLKSKWFVICLAAAAIFTVTGAGQPDQADFHVTERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=919848 VO180_RS17740 WP_031378677.1 3616850..3616969(-) (phrC) [Bacillus velezensis strain XHA16]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGCCAGA
TCAGGCTGACTTCCATGTAACTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

75

100

0.769