Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   U6I89_RS12660 Genome accession   NZ_CP141263
Coordinates   2530071..2530445 (-) Length   124 a.a.
NCBI ID   WP_060399015.1    Uniprot ID   -
Organism   Bacillus inaquosorum strain BIM B-2002     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2525071..2535445
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U6I89_RS12620 (U6I89_12620) - 2525395..2526189 (+) 795 WP_003236936.1 YqhG family protein -
  U6I89_RS12625 (U6I89_12625) sinI 2526374..2526547 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  U6I89_RS12630 (U6I89_12630) sinR 2526581..2526916 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  U6I89_RS12635 (U6I89_12635) tasA 2527011..2527796 (-) 786 WP_003236939.1 biofilm matrix protein TasA -
  U6I89_RS12640 (U6I89_12640) sipW 2527860..2528432 (-) 573 WP_080429111.1 signal peptidase I SipW -
  U6I89_RS12645 (U6I89_12645) tapA 2528416..2529180 (-) 765 WP_060399014.1 amyloid fiber anchoring/assembly protein TapA -
  U6I89_RS12650 (U6I89_12650) - 2529453..2529779 (+) 327 WP_029316858.1 YqzG/YhdC family protein -
  U6I89_RS12655 (U6I89_12655) - 2529821..2530000 (-) 180 WP_003236949.1 YqzE family protein -
  U6I89_RS12660 (U6I89_12660) comGG 2530071..2530445 (-) 375 WP_060399015.1 competence type IV pilus minor pilin ComGG Machinery gene
  U6I89_RS12665 (U6I89_12665) comGF 2530446..2530829 (-) 384 WP_060399016.1 competence type IV pilus minor pilin ComGF Machinery gene
  U6I89_RS12670 (U6I89_12670) comGE 2530855..2531199 (-) 345 WP_060399017.1 competence type IV pilus minor pilin ComGE Machinery gene
  U6I89_RS12675 (U6I89_12675) comGD 2531183..2531614 (-) 432 WP_060399018.1 competence type IV pilus minor pilin ComGD Machinery gene
  U6I89_RS12680 (U6I89_12680) comGC 2531604..2531900 (-) 297 WP_003236957.1 comG operon protein ComGC Machinery gene
  U6I89_RS12685 (U6I89_12685) comGB 2531914..2532951 (-) 1038 WP_060399019.1 competence type IV pilus assembly protein ComGB Machinery gene
  U6I89_RS12690 (U6I89_12690) comGA 2532938..2534008 (-) 1071 WP_060399020.1 competence protein ComGA Machinery gene
  U6I89_RS12695 (U6I89_12695) - 2533971..2534246 (-) 276 WP_060399021.1 hypothetical protein -
  U6I89_RS12700 (U6I89_12700) - 2534224..2534634 (-) 411 WP_060399022.1 CBS domain-containing protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14278.51 Da        Isoelectric Point: 10.2570

>NTDB_id=916556 U6I89_RS12660 WP_060399015.1 2530071..2530445(-) (comGG) [Bacillus inaquosorum strain BIM B-2002]
MYRSKGFIYPAVLFVSALVLLIVNFTAAQYISRCMFEKETKAFYTGENLLQNGALLSIRHVLEQRKGQKGSQQFTYGQVS
YHIHNTSIKEQKQISLKAITESGAERTAQLVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=916556 U6I89_RS12660 WP_060399015.1 2530071..2530445(-) (comGG) [Bacillus inaquosorum strain BIM B-2002]
ATGTACCGTTCGAAAGGGTTTATTTATCCCGCTGTTCTTTTTGTCTCCGCGCTTGTGCTGCTGATCGTAAACTTTACTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGCGTTTTACACAGGAGAAAATTTGCTTCAGAATGGCG
CACTTCTTTCAATTCGGCATGTTCTTGAGCAGCGGAAAGGCCAAAAGGGTTCACAGCAGTTTACATATGGGCAGGTTTCT
TATCACATTCACAATACATCGATAAAAGAGCAAAAACAAATCAGCTTAAAAGCCATTACGGAGTCGGGAGCAGAAAGAAC
TGCACAGCTAGTGTTCGATCAAAAACAGAAAAAACTGCTGCGCTGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

82.258

100

0.823