Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   U6I89_RS12625 Genome accession   NZ_CP141263
Coordinates   2526374..2526547 (+) Length   57 a.a.
NCBI ID   WP_003226347.1    Uniprot ID   G4NQ83
Organism   Bacillus inaquosorum strain BIM B-2002     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2521374..2531547
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U6I89_RS12610 (U6I89_12610) gcvT 2522169..2523257 (-) 1089 WP_060399011.1 glycine cleavage system aminomethyltransferase GcvT -
  U6I89_RS12615 (U6I89_12615) - 2523701..2525374 (+) 1674 WP_060399012.1 DEAD/DEAH box helicase -
  U6I89_RS12620 (U6I89_12620) - 2525395..2526189 (+) 795 WP_003236936.1 YqhG family protein -
  U6I89_RS12625 (U6I89_12625) sinI 2526374..2526547 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  U6I89_RS12630 (U6I89_12630) sinR 2526581..2526916 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  U6I89_RS12635 (U6I89_12635) tasA 2527011..2527796 (-) 786 WP_003236939.1 biofilm matrix protein TasA -
  U6I89_RS12640 (U6I89_12640) sipW 2527860..2528432 (-) 573 WP_080429111.1 signal peptidase I SipW -
  U6I89_RS12645 (U6I89_12645) tapA 2528416..2529180 (-) 765 WP_060399014.1 amyloid fiber anchoring/assembly protein TapA -
  U6I89_RS12650 (U6I89_12650) - 2529453..2529779 (+) 327 WP_029316858.1 YqzG/YhdC family protein -
  U6I89_RS12655 (U6I89_12655) - 2529821..2530000 (-) 180 WP_003236949.1 YqzE family protein -
  U6I89_RS12660 (U6I89_12660) comGG 2530071..2530445 (-) 375 WP_060399015.1 competence type IV pilus minor pilin ComGG Machinery gene
  U6I89_RS12665 (U6I89_12665) comGF 2530446..2530829 (-) 384 WP_060399016.1 competence type IV pilus minor pilin ComGF Machinery gene
  U6I89_RS12670 (U6I89_12670) comGE 2530855..2531199 (-) 345 WP_060399017.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6632.64 Da        Isoelectric Point: 8.6596

>NTDB_id=916554 U6I89_RS12625 WP_003226347.1 2526374..2526547(+) (sinI) [Bacillus inaquosorum strain BIM B-2002]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=916554 U6I89_RS12625 WP_003226347.1 2526374..2526547(+) (sinI) [Bacillus inaquosorum strain BIM B-2002]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4NQ83

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

96.491

100

0.965