Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   S0I03_RS12250 Genome accession   NZ_CP140613
Coordinates   2507399..2507836 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain WN-I     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2502399..2512836
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S0I03_RS12200 sinI 2502782..2502955 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  S0I03_RS12205 sinR 2502989..2503324 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  S0I03_RS12210 tasA 2503372..2504157 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  S0I03_RS12215 sipW 2504222..2504806 (-) 585 WP_014418370.1 signal peptidase I SipW -
  S0I03_RS12220 tapA 2504778..2505449 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  S0I03_RS12225 - 2505708..2506037 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  S0I03_RS12230 - 2506078..2506257 (-) 180 WP_003153093.1 YqzE family protein -
  S0I03_RS12235 comGG 2506314..2506691 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  S0I03_RS12240 comGF 2506692..2507087 (-) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  S0I03_RS12245 comGE 2507101..2507415 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  S0I03_RS12250 comGD 2507399..2507836 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  S0I03_RS12255 comGC 2507826..2508134 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  S0I03_RS12260 comGB 2508139..2509176 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  S0I03_RS12265 comGA 2509163..2510233 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  S0I03_RS12270 - 2510426..2511376 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  S0I03_RS12275 - 2511521..2512822 (+) 1302 WP_029973873.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=914843 S0I03_RS12250 WP_007612572.1 2507399..2507836(-) (comGD) [Bacillus velezensis strain WN-I]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=914843 S0I03_RS12250 WP_007612572.1 2507399..2507836(-) (comGD) [Bacillus velezensis strain WN-I]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTACTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATACAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559