Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   S0I03_RS12200 Genome accession   NZ_CP140613
Coordinates   2502782..2502955 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain WN-I     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2497782..2507955
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  S0I03_RS12185 gcvT 2498595..2499695 (-) 1101 WP_014418366.1 glycine cleavage system aminomethyltransferase GcvT -
  S0I03_RS12190 - 2500119..2501789 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  S0I03_RS12195 - 2501811..2502605 (+) 795 WP_014418368.1 YqhG family protein -
  S0I03_RS12200 sinI 2502782..2502955 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  S0I03_RS12205 sinR 2502989..2503324 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  S0I03_RS12210 tasA 2503372..2504157 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  S0I03_RS12215 sipW 2504222..2504806 (-) 585 WP_014418370.1 signal peptidase I SipW -
  S0I03_RS12220 tapA 2504778..2505449 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  S0I03_RS12225 - 2505708..2506037 (+) 330 WP_014418372.1 DUF3889 domain-containing protein -
  S0I03_RS12230 - 2506078..2506257 (-) 180 WP_003153093.1 YqzE family protein -
  S0I03_RS12235 comGG 2506314..2506691 (-) 378 WP_014418373.1 competence type IV pilus minor pilin ComGG Machinery gene
  S0I03_RS12240 comGF 2506692..2507087 (-) 396 WP_014721501.1 competence type IV pilus minor pilin ComGF -
  S0I03_RS12245 comGE 2507101..2507415 (-) 315 WP_032863566.1 competence type IV pilus minor pilin ComGE Machinery gene
  S0I03_RS12250 comGD 2507399..2507836 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=914839 S0I03_RS12200 WP_014418369.1 2502782..2502955(+) (sinI) [Bacillus velezensis strain WN-I]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=914839 S0I03_RS12200 WP_014418369.1 2502782..2502955(+) (sinI) [Bacillus velezensis strain WN-I]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719