Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   L6450_RS12900 Genome accession   NZ_AP025340
Coordinates   2529337..2529477 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain J36TS2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2524337..2534477
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L6450_RS12875 - 2524630..2525019 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  L6450_RS12880 comA 2525036..2525674 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  L6450_RS12885 comP 2525761..2528076 (-) 2316 WP_020452789.1 sensor histidine kinase Regulator
  L6450_RS12890 comX 2528097..2528267 (-) 171 WP_020452790.1 competence pheromone ComX -
  L6450_RS12895 - 2528239..2529150 (-) 912 WP_020452791.1 polyprenyl synthetase family protein -
  L6450_RS12900 degQ 2529337..2529477 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  L6450_RS12905 - 2529963..2530310 (+) 348 WP_223254849.1 hypothetical protein -
  L6450_RS12910 - 2530353..2531573 (-) 1221 WP_020452793.1 EAL and HDOD domain-containing protein -
  L6450_RS12915 - 2531751..2533160 (-) 1410 WP_235442597.1 nicotinate phosphoribosyltransferase -
  L6450_RS12920 - 2533238..2533789 (-) 552 WP_020452795.1 cysteine hydrolase family protein -
  L6450_RS12925 - 2533975..2534376 (-) 402 WP_039072963.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=91404 L6450_RS12900 WP_003184860.1 2529337..2529477(-) (degQ) [Bacillus paralicheniformis strain J36TS2]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=91404 L6450_RS12900 WP_003184860.1 2529337..2529477(-) (degQ) [Bacillus paralicheniformis strain J36TS2]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P69890

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652


Multiple sequence alignment