Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   U3P88_RS05290 Genome accession   NZ_CP140297
Coordinates   1208346..1208723 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain UMAF6639     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1203346..1213723
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U3P88_RS05250 (U3P88_05250) - 1203844..1204638 (+) 795 WP_061860710.1 YqhG family protein -
  U3P88_RS05255 (U3P88_05255) sinI 1204815..1204988 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  U3P88_RS05260 (U3P88_05260) sinR 1205022..1205357 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  U3P88_RS05265 (U3P88_05265) - 1205405..1206190 (-) 786 WP_007408329.1 TasA family protein -
  U3P88_RS05270 (U3P88_05270) - 1206255..1206839 (-) 585 WP_061860711.1 signal peptidase I -
  U3P88_RS05275 (U3P88_05275) tapA 1206811..1207482 (-) 672 WP_060674605.1 amyloid fiber anchoring/assembly protein TapA -
  U3P88_RS05280 (U3P88_05280) - 1207741..1208070 (+) 330 WP_060674607.1 DUF3889 domain-containing protein -
  U3P88_RS05285 (U3P88_05285) - 1208110..1208289 (-) 180 WP_003153093.1 YqzE family protein -
  U3P88_RS05290 (U3P88_05290) comGG 1208346..1208723 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  U3P88_RS05295 (U3P88_05295) comGF 1208724..1209119 (-) 396 WP_060674609.1 competence type IV pilus minor pilin ComGF -
  U3P88_RS05300 (U3P88_05300) comGE 1209133..1209447 (-) 315 WP_060674611.1 competence type IV pilus minor pilin ComGE -
  U3P88_RS05305 (U3P88_05305) comGD 1209431..1209868 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  U3P88_RS05310 (U3P88_05310) comGC 1209858..1210124 (-) 267 WP_060674857.1 competence type IV pilus major pilin ComGC Machinery gene
  U3P88_RS05315 (U3P88_05315) comGB 1210171..1211208 (-) 1038 WP_060674612.1 competence type IV pilus assembly protein ComGB Machinery gene
  U3P88_RS05320 (U3P88_05320) comGA 1211195..1212265 (-) 1071 WP_060674614.1 competence type IV pilus ATPase ComGA Machinery gene
  U3P88_RS05325 (U3P88_05325) - 1212458..1213408 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=913520 U3P88_RS05290 WP_015417814.1 1208346..1208723(-) (comGG) [Bacillus velezensis strain UMAF6639]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=913520 U3P88_RS05290 WP_015417814.1 1208346..1208723(-) (comGG) [Bacillus velezensis strain UMAF6639]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAATACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504