Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   U3P88_RS05255 Genome accession   NZ_CP140297
Coordinates   1204815..1204988 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain UMAF6639     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1199815..1209988
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U3P88_RS05240 (U3P88_05240) gcvT 1200628..1201728 (-) 1101 WP_061860709.1 glycine cleavage system aminomethyltransferase GcvT -
  U3P88_RS05245 (U3P88_05245) - 1202152..1203822 (+) 1671 WP_031378948.1 SNF2-related protein -
  U3P88_RS05250 (U3P88_05250) - 1203844..1204638 (+) 795 WP_061860710.1 YqhG family protein -
  U3P88_RS05255 (U3P88_05255) sinI 1204815..1204988 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  U3P88_RS05260 (U3P88_05260) sinR 1205022..1205357 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  U3P88_RS05265 (U3P88_05265) - 1205405..1206190 (-) 786 WP_007408329.1 TasA family protein -
  U3P88_RS05270 (U3P88_05270) - 1206255..1206839 (-) 585 WP_061860711.1 signal peptidase I -
  U3P88_RS05275 (U3P88_05275) tapA 1206811..1207482 (-) 672 WP_060674605.1 amyloid fiber anchoring/assembly protein TapA -
  U3P88_RS05280 (U3P88_05280) - 1207741..1208070 (+) 330 WP_060674607.1 DUF3889 domain-containing protein -
  U3P88_RS05285 (U3P88_05285) - 1208110..1208289 (-) 180 WP_003153093.1 YqzE family protein -
  U3P88_RS05290 (U3P88_05290) comGG 1208346..1208723 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  U3P88_RS05295 (U3P88_05295) comGF 1208724..1209119 (-) 396 WP_060674609.1 competence type IV pilus minor pilin ComGF -
  U3P88_RS05300 (U3P88_05300) comGE 1209133..1209447 (-) 315 WP_060674611.1 competence type IV pilus minor pilin ComGE -
  U3P88_RS05305 (U3P88_05305) comGD 1209431..1209868 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=913518 U3P88_RS05255 WP_003153105.1 1204815..1204988(+) (sinI) [Bacillus velezensis strain UMAF6639]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=913518 U3P88_RS05255 WP_003153105.1 1204815..1204988(+) (sinI) [Bacillus velezensis strain UMAF6639]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702