Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   L6432_RS11125 Genome accession   NZ_AP025339
Coordinates   2208533..2208673 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain J25TS1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2203533..2213673
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L6432_RS11100 - 2203826..2204215 (-) 390 WP_009329508.1 hotdog fold thioesterase -
  L6432_RS11105 comA 2204232..2204870 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  L6432_RS11110 comP 2204957..2207272 (-) 2316 WP_020452789.1 sensor histidine kinase Regulator
  L6432_RS11115 comX 2207293..2207463 (-) 171 WP_020452790.1 competence pheromone ComX -
  L6432_RS11120 - 2207435..2208346 (-) 912 WP_035337591.1 polyprenyl synthetase family protein -
  L6432_RS11125 degQ 2208533..2208673 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  L6432_RS11130 - 2209159..2209506 (+) 348 WP_223254849.1 hypothetical protein -
  L6432_RS11135 - 2209549..2210769 (-) 1221 WP_035337594.1 EAL and HDOD domain-containing protein -
  L6432_RS11140 - 2210947..2212356 (-) 1410 WP_229029889.1 nicotinate phosphoribosyltransferase -
  L6432_RS11145 - 2212434..2212985 (-) 552 WP_020452795.1 cysteine hydrolase family protein -
  L6432_RS11150 - 2213171..2213572 (-) 402 WP_026580054.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=91330 L6432_RS11125 WP_003184860.1 2208533..2208673(-) (degQ) [Bacillus paralicheniformis strain J25TS1]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=91330 L6432_RS11125 WP_003184860.1 2208533..2208673(-) (degQ) [Bacillus paralicheniformis strain J25TS1]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment