Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   U0449_RS02780 Genome accession   NZ_CP139862
Coordinates   552615..552764 (-) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain 05H0020-2     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 547615..557764
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U0449_RS02745 ccrZ 547795..548589 (-) 795 WP_000363002.1 cell cycle regulator CcrZ -
  U0449_RS02750 - 548750..549361 (-) 612 WP_000394040.1 CPBP family intramembrane glutamic endopeptidase -
  U0449_RS02755 blpZ 549512..549745 (-) 234 WP_000276498.1 immunity protein BlpZ -
  U0449_RS02760 - 549787..550476 (-) 690 WP_000760523.1 CPBP family intramembrane glutamic endopeptidase -
  U0449_RS02765 - 550528..550911 (-) 384 WP_016398494.1 hypothetical protein -
  U0449_RS02770 - 551540..551872 (-) 333 WP_224757293.1 immunity protein -
  U0449_RS02775 - 552392..552511 (-) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  U0449_RS02780 cipB 552615..552764 (-) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  U0449_RS02785 blpK 553008..553256 (-) 249 WP_000379965.1 bacteriocin-like peptide BlpK -
  U0449_RS02790 blpJ 553325..553594 (-) 270 WP_044791635.1 bacteriocin-like peptide BlpJ -
  U0449_RS02795 blpI 554071..554268 (-) 198 WP_001093266.1 bacteriocin-like peptide BlpI -
  U0449_RS02800 comA/nlmT 554543..555130 (+) 588 WP_050218844.1 cysteine peptidase family C39 domain-containing protein Regulator
  U0449_RS02805 comA/nlmT 555057..556700 (+) 1644 WP_078136507.1 peptide cleavage/export ABC transporter Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=911464 U0449_RS02780 WP_001809846.1 552615..552764(-) (cipB) [Streptococcus pneumoniae strain 05H0020-2]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=911464 U0449_RS02780 WP_001809846.1 552615..552764(-) (cipB) [Streptococcus pneumoniae strain 05H0020-2]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531