Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   SD437_RS15740 Genome accession   NZ_CP139565
Coordinates   3118008..3118148 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain NCCP     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3113008..3123148
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SD437_RS15715 - 3113354..3113737 (-) 384 WP_017419422.1 hotdog fold thioesterase -
  SD437_RS15720 comA 3113759..3114403 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  SD437_RS15725 comP 3114484..3116784 (-) 2301 WP_345912442.1 histidine kinase Regulator
  SD437_RS15730 comX 3116798..3116971 (-) 174 WP_345912443.1 competence pheromone ComX -
  SD437_RS15735 - 3116940..3117800 (-) 861 WP_157774448.1 polyprenyl synthetase family protein -
  SD437_RS15740 degQ 3118008..3118148 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  SD437_RS15745 - 3118613..3118954 (+) 342 WP_014418765.1 hypothetical protein -
  SD437_RS15750 - 3118961..3120184 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  SD437_RS15755 - 3120314..3121780 (-) 1467 WP_106067969.1 nicotinate phosphoribosyltransferase -
  SD437_RS15760 - 3121798..3122349 (-) 552 WP_025853916.1 isochorismatase family cysteine hydrolase -
  SD437_RS15765 - 3122446..3122844 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=910243 SD437_RS15740 WP_003152043.1 3118008..3118148(-) (degQ) [Bacillus velezensis strain NCCP]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=910243 SD437_RS15740 WP_003152043.1 3118008..3118148(-) (degQ) [Bacillus velezensis strain NCCP]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891