Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   R6Z04_RS17250 Genome accession   NZ_CP139440
Coordinates   3256762..3256902 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain GUCC4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3251762..3261902
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6Z04_RS17225 (R6Z04_17225) yuxO 3252076..3252456 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  R6Z04_RS17230 (R6Z04_17230) comA 3252475..3253119 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  R6Z04_RS17235 (R6Z04_17235) comP 3253200..3255508 (-) 2309 Protein_3333 two-component system sensor histidine kinase ComP -
  R6Z04_RS17240 (R6Z04_17240) comX 3255523..3255690 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  R6Z04_RS17245 (R6Z04_17245) comQ 3255678..3256577 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  R6Z04_RS17250 (R6Z04_17250) degQ 3256762..3256902 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  R6Z04_RS17255 (R6Z04_17255) - 3257124..3257249 (+) 126 WP_003228793.1 hypothetical protein -
  R6Z04_RS17260 (R6Z04_17260) - 3257363..3257731 (+) 369 WP_003243784.1 hypothetical protein -
  R6Z04_RS17265 (R6Z04_17265) pdeH 3257707..3258936 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  R6Z04_RS17270 (R6Z04_17270) pncB 3259073..3260545 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  R6Z04_RS17275 (R6Z04_17275) pncA 3260561..3261112 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  R6Z04_RS17280 (R6Z04_17280) yueI 3261209..3261607 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=909813 R6Z04_RS17250 WP_003220708.1 3256762..3256902(-) (degQ) [Bacillus subtilis strain GUCC4]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=909813 R6Z04_RS17250 WP_003220708.1 3256762..3256902(-) (degQ) [Bacillus subtilis strain GUCC4]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1