Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   R6Z04_RS17240 Genome accession   NZ_CP139440
Coordinates   3255523..3255690 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain GUCC4     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3250523..3260690
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R6Z04_RS17210 (R6Z04_17210) mrpE 3250919..3251395 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  R6Z04_RS17215 (R6Z04_17215) mrpF 3251395..3251679 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  R6Z04_RS17220 (R6Z04_17220) mnhG 3251663..3252037 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  R6Z04_RS17225 (R6Z04_17225) yuxO 3252076..3252456 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  R6Z04_RS17230 (R6Z04_17230) comA 3252475..3253119 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  R6Z04_RS17235 (R6Z04_17235) comP 3253200..3255508 (-) 2309 Protein_3333 two-component system sensor histidine kinase ComP -
  R6Z04_RS17240 (R6Z04_17240) comX 3255523..3255690 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  R6Z04_RS17245 (R6Z04_17245) comQ 3255678..3256577 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  R6Z04_RS17250 (R6Z04_17250) degQ 3256762..3256902 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  R6Z04_RS17255 (R6Z04_17255) - 3257124..3257249 (+) 126 WP_003228793.1 hypothetical protein -
  R6Z04_RS17260 (R6Z04_17260) - 3257363..3257731 (+) 369 WP_003243784.1 hypothetical protein -
  R6Z04_RS17265 (R6Z04_17265) pdeH 3257707..3258936 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  R6Z04_RS17270 (R6Z04_17270) pncB 3259073..3260545 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=909811 R6Z04_RS17240 WP_003242801.1 3255523..3255690(-) (comX) [Bacillus subtilis strain GUCC4]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=909811 R6Z04_RS17240 WP_003242801.1 3255523..3255690(-) (comX) [Bacillus subtilis strain GUCC4]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1