Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   SD459_RS12340 Genome accession   NZ_CP138627
Coordinates   2494561..2494875 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain AYGS-17     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2489561..2499875
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SD459_RS12295 (SD459_12290) sinI 2490242..2490415 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  SD459_RS12300 (SD459_12295) sinR 2490449..2490784 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SD459_RS12305 (SD459_12300) tasA 2490832..2491617 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  SD459_RS12310 (SD459_12305) sipW 2491682..2492266 (-) 585 WP_014418370.1 signal peptidase I SipW -
  SD459_RS12315 (SD459_12310) tapA 2492238..2492909 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  SD459_RS12320 (SD459_12315) - 2493168..2493497 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  SD459_RS12325 (SD459_12320) - 2493538..2493717 (-) 180 WP_003153093.1 YqzE family protein -
  SD459_RS12330 (SD459_12325) comGG 2493774..2494151 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  SD459_RS12335 (SD459_12330) comGF 2494152..2494547 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  SD459_RS12340 (SD459_12335) comGE 2494561..2494875 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  SD459_RS12345 (SD459_12340) comGD 2494859..2495296 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  SD459_RS12350 (SD459_12345) comGC 2495286..2495552 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  SD459_RS12355 (SD459_12350) comGB 2495599..2496636 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  SD459_RS12360 (SD459_12355) comGA 2496623..2497693 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  SD459_RS12365 (SD459_12360) - 2497886..2498836 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=903747 SD459_RS12340 WP_017418140.1 2494561..2494875(-) (comGE) [Bacillus velezensis strain AYGS-17]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=903747 SD459_RS12340 WP_017418140.1 2494561..2494875(-) (comGE) [Bacillus velezensis strain AYGS-17]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481