Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   SD459_RS12350 Genome accession   NZ_CP138627
Coordinates   2495286..2495552 (-) Length   88 a.a.
NCBI ID   WP_050496152.1    Uniprot ID   -
Organism   Bacillus velezensis strain AYGS-17     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2490286..2500552
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SD459_RS12300 (SD459_12295) sinR 2490449..2490784 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  SD459_RS12305 (SD459_12300) tasA 2490832..2491617 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  SD459_RS12310 (SD459_12305) sipW 2491682..2492266 (-) 585 WP_014418370.1 signal peptidase I SipW -
  SD459_RS12315 (SD459_12310) tapA 2492238..2492909 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  SD459_RS12320 (SD459_12315) - 2493168..2493497 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  SD459_RS12325 (SD459_12320) - 2493538..2493717 (-) 180 WP_003153093.1 YqzE family protein -
  SD459_RS12330 (SD459_12325) comGG 2493774..2494151 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  SD459_RS12335 (SD459_12330) comGF 2494152..2494547 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  SD459_RS12340 (SD459_12335) comGE 2494561..2494875 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  SD459_RS12345 (SD459_12340) comGD 2494859..2495296 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  SD459_RS12350 (SD459_12345) comGC 2495286..2495552 (-) 267 WP_050496152.1 competence type IV pilus major pilin ComGC Machinery gene
  SD459_RS12355 (SD459_12350) comGB 2495599..2496636 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  SD459_RS12360 (SD459_12355) comGA 2496623..2497693 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  SD459_RS12365 (SD459_12360) - 2497886..2498836 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  SD459_RS12370 (SD459_12365) - 2498982..2500283 (+) 1302 WP_025649848.1 hemolysin family protein -

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9740.36 Da        Isoelectric Point: 6.4456

>NTDB_id=903749 SD459_RS12350 WP_050496152.1 2495286..2495552(-) (comGC) [Bacillus velezensis strain AYGS-17]
MLIVLFIVSILLLITIPNVTKHNQSIQRKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=903749 SD459_RS12350 WP_050496152.1 2495286..2495552(-) (comGC) [Bacillus velezensis strain AYGS-17]
ATGCTGATTGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCGTAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGACCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

73.611

81.818

0.602